SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007463 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007463
Domain Number 1 Region: 181-505
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 1.08e-64
Family Glutamine synthetase catalytic domain 0.00056
Further Details:      
 
Domain Number 2 Region: 71-177
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 7.98e-20
Family Glutamine synthetase, N-terminal domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007463   Gene: ENSMMUG00000005648   Transcript: ENSMMUT00000007940
Sequence length 507
Comment pep:known chromosome:MMUL_1:4:59715207:59756087:-1 gene:ENSMMUG00000005648 transcript:ENSMMUT00000007940 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNNEEDFLQKDSTRDEGSETEDNSMNKLRRKKVTKPRVCSTEVGEMDMSNSNDCMRDSSQ
ILAPPQLSSRMKHIRQAMAKNRLQFVRFEATDLHGVSRSKTIPAHFFQEKVSHGVCMPRG
YLEVIPNPKDSEMNRIRATCFNSDIVLMPEISTFRVLPWADRTARVICDTFTVTGEPLLT
SPRYIAKRQLSQLQASGFSLLSAFICDFCIFGVPEFLNSKTISFPASTFLNNHDQPFMQE
LVDGLYHTGANVESFSSSTRPGQMEICFLPEFGISSADNAFTLRTGVKEVARKYNYISSF
FIETGFCNSGILSHSLWDVDRKKNMFCSTSGTEQLTITGKKWLAGLLKHSAALSCLMAPT
VSCRKRYSKDRKDLKDSVPTTWGYNDNSCIFNIKCHGEKGARIENKLGSATANPYLVLAA
TVAAGLDGLHSSNEVLAGPDESTDFYQAETSEIPLKLEDALVALEEDQCLRQALGETFIR
YFVAMKKYELENEEIAAERNKFLEYFI
Download sequence
Identical sequences F6W4Y0 G7P2X5
9544.ENSMMUP00000007463 ENSMMUP00000007463 ENSMMUP00000007463 XP_001106349.2.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]