SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007490 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007490
Domain Number 1 Region: 10-180,282-380
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.33e-49
Family FAD-linked reductases, N-terminal domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007490   Gene: ENSMMUG00000005668   Transcript: ENSMMUT00000007969
Sequence length 458
Comment pep:known chromosome:MMUL_1:1:215460410:215516673:-1 gene:ENSMMUG00000005668 transcript:ENSMMUT00000007969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSSVIQRKKVAVIGGGLVGSLQACFLAKRNFQIDVYEAREDPRVADFTRGRSINLALSH
RGRQALKAVGLEDQIVSQGIPMRARMIHSLSGKKSAVPYGTKSQYILSVSRENLNKDLLT
AAEKNPGVKMHFNHKLLKCNPEEGMITVLGSDKVPKDVTCDLIVGCDGAYSTVRSHLMKK
PRFDYSQQYIPHGYMELTIPPKNGDYAMEPNYLHIWPRNTFMMIALPNMSKSFTCTLFMP
FDEFDKLLTSNDVIDFFQKYFPDAIPLIGEKLLVQDFFLLPAQPMISVKCSSFHFQSHCV
LLGDAAHAIVPFFGQGMNAGFEDCLVFDELMDKFNNDLSLCLPAFSRLRIPDSHAISDLS
MYNYIEMRAHVNSSWFIFQKNMGRFLHAIMPSTFIPLYTMVSFSRIRYHEAVQRWHWQKK
VIYKGLLFLGSLIAISSTYLLMHYMSPRPFHYFRRPWN
Download sequence
Identical sequences A0A1D5QS97 A0A2K6DZB6 G7NWM3
9544.ENSMMUP00000037475 XP_001093900.1.72884 XP_005539728.2.63531 XP_011727776.1.29376 ENSMMUP00000037475 ENSMMUP00000007490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]