SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007574 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007574
Domain Number 1 Region: 153-421
Classification Level Classification E-value
Superfamily Subtilisin-like 1.31e-55
Family Subtilases 0.0000233
Further Details:      
 
Domain Number 2 Region: 74-151
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.0000000051
Family Subtilase propeptides/inhibitors 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007574   Gene: ENSMMUG00000005736   Transcript: ENSMMUT00000008056
Sequence length 689
Comment pep:known chromosome:MMUL_1:1:57888964:57912771:1 gene:ENSMMUG00000005736 transcript:ENSMMUT00000008056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTVSSRRSWWPLPLPLLLLLLLGPAGARAQEDEDGDYEELVLALRSEEDGLADAPEHGA
TATFHRCAKDPWRLPGTYVVVLKEETHRSQSERTARRLQAQAARRGYLTKILHVFHHLLP
GFLVKMSGDLLELALKLPHVDYIEEDSSVFAQSIPWNLERITPARYRADEYQPPKGGSLV
EVYLLDTSIQSDHREIEGRVMVTDFESVPEEDGTRFHRQASKCDSHGTHLAGVVSGRDAG
VAKGAGLRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVFNAA
CQRLARAGVVLVTAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVD
LFAPGEDIIGASSDCSTCFVSRSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFSA
KDVINEAWFPEDQRVLTPNLVAALPPSTHRAGWQLFCRTVWSAHSGPTRMATAVARCAQD
EELLSCSSFSRSGKRRGERIEAQGGKRVCRAHNAFGGEGVYAIARCCLLPQVNCSEQVRR
PVRTGGWGAVGWRESLLCSFSGSVCATTIPPCIRVAVCRVDAVGSFRHRVDSVCMYLCVA
GSVFAFVQISGGPGPCWTVIVACEDGWTLTGCSPLPGTSHVLGAYAVDNTCVVRSRDVST
TGSTSKEAVAAVAICCRSRHLVQASQELQ
Download sequence
Identical sequences ENSMMUP00000007574 ENSMMUP00000007574 9544.ENSMMUP00000007574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]