SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007581 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007581
Domain Number 1 Region: 4-43
Classification Level Classification E-value
Superfamily UBA-like 0.00000146
Family UBA domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007581   Gene: ENSMMUG00000005743   Transcript: ENSMMUT00000008064
Sequence length 419
Comment pep:known chromosome:MMUL_1:1:58007440:58063369:-1 gene:ENSMMUG00000005743 transcript:ENSMMUT00000008064 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESEEEQHMTTLLCMGFSDPATIRKALRLAKNDINEAVALLTNERPGLDYGGYEPLRPPA
RLPRGGGRGVSGAEEKGMGHSNGLKTDGEVGFRPLPSFIKMVGVEKNDENGNCSGEGIEF
PTTNLYELESRVLTDHWSIPYKREESLGKCLLASTYLARLGLSESDENCKRFMDRCMPEA
FKKLLTSSAVHKWGTEIHEGIYNMLMLLIELVAERIKQDPIPIGLLGVLTMAFNPDNEYH
FKNRMKVSQRNWAEVFGEGNMFAVSPVSTFQKEPHGWVVDLVNKFGELGGFAAIQAKLHS
EDIELGAVSALIQPLGVCAEYLSSSVVQPMLDPVILTTIQDVRSVEEKDLKDKKRLVSIP
ELLSAIKLLCMRFQPDLVTIVDDLRLDILLRMLKSPHFSAKMNSLKEVSLLTSYNWPLI
Download sequence
Identical sequences ENSMMUP00000007581 ENSMMUP00000007581 9544.ENSMMUP00000007581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]