SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007582 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007582
Domain Number 1 Region: 124-198
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.27e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007582   Gene: ENSMMUG00000005747   Transcript: ENSMMUT00000008065
Sequence length 238
Comment pep:known chromosome:MMUL_1:11:104122966:104125797:1 gene:ENSMMUG00000005747 transcript:ENSMMUT00000008065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESSAKMESGGAGQQPQPQPQPQPQQPFLPPAACFFATAAAAAAAAAAAAAQSAQQQQQQ
QQQQAPQLRPAADGQPSGGGHKSAPKQVKRQRSSSPELMRCKRRLNFSGFGYSLPQQQPA
AVARRNERERNRVKLVNLGFATLREHVPNGAANKKMSKVETLRSAVEYIRALQQLLDEHD
AVSAAFQAGVLSPTISPNYSNDLNSMAGSPVSSYSSDEGSYDPLSPEEQELLDFTNWF
Download sequence
Identical sequences F6TP46
9544.ENSMMUP00000007582 ENSMMUP00000007582 ENSMMUP00000007582 XP_001094978.1.72884 XP_011824028.1.47321 XP_011888066.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]