SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007605 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007605
Domain Number 1 Region: 1-67
Classification Level Classification E-value
Superfamily E set domains 0.00000000000496
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.048
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000007605
Domain Number - Region: 74-122
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.024
Family HLH, helix-loop-helix DNA-binding domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007605   Gene: ENSMMUG00000005760   Transcript: ENSMMUT00000008088
Sequence length 306
Comment pep:known chromosome:MMUL_1:8:25964090:26007636:-1 gene:ENSMMUG00000005760 transcript:ENSMMUT00000008088 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVIIIGDNFFDGLQVVFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGA
PGRFIYTALNEPTIDYGFQRLQKVIPRHPGDPERLAKEMLLKRAADLVEALYGTPHNNQD
IILKRAADIAEALYSVPRNPSQLPALSSSPAHSGMMGINSYGSQLGVSISESTQGNNQGY
IRNTSSISPRGYSSSSTPQQSNYSTSSNSMNGYSNVPMANLGVPGSPGFLNGSPTGSPYG
IMSSSPTVGSSSTSSILPFSSSVFPAVKQKSAFAPVIRPQGSPSPACSSGNGNGFRAMTG
LVVPPM
Download sequence
Identical sequences G7PCX6
ENSMMUP00000007605 ENSMMUP00000032172 9544.ENSMMUP00000032172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]