SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007607 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007607
Domain Number 1 Region: 153-284
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.98e-22
Family UBX domain 0.015
Further Details:      
 
Domain Number 2 Region: 6-54
Classification Level Classification E-value
Superfamily UBA-like 8.62e-17
Family UBA domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007607   Gene: ENSMMUG00000005761   Transcript: ENSMMUT00000008090
Sequence length 310
Comment pep:known chromosome:MMUL_1:14:11407385:11409933:1 gene:ENSMMUG00000005761 transcript:ENSMMUT00000008090 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELTALESLIEMGFPRGRAEKALALTGNQGIEAAMDWLMEHEDDPDVDEPLETPLGHVL
GREPTSSEQGGLEGSGSAAGEGKPILSEEERQEQTKRMLELVAQKQREREEREEREALER
ERQRRRQGQELSAARQRLQEDEMRRAAEERRREKAEELAARQRVREKIERDKAERAKKYG
GSVGSQPPPPAPEPGPVPSSPSQEPPTKREYDQCRIQVRLPDGTSLTQTFRAREQLAAVR
LYVELHRGEEPGGGQDPVQLLSGFPRRAFSEADMERPLQELGMAARLETRTWGSREACLG
KGGMQREGVL
Download sequence
Identical sequences H9Z9J6
ENSMMUP00000007607 9544.ENSMMUP00000007607 XP_014969447.1.72884 ENSMMUP00000007607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]