SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007625 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007625
Domain Number 1 Region: 338-482
Classification Level Classification E-value
Superfamily Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 5.1e-37
Family Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.0038
Further Details:      
 
Domain Number 2 Region: 78-331
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.71e-28
Family G proteins 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007625   Gene: ENSMMUG00000005776   Transcript: ENSMMUT00000008108
Sequence length 567
Comment pep:known chromosome:MMUL_1:14:10781547:10826622:1 gene:ENSMMUG00000005776 transcript:ENSMMUT00000008108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTAGRDPVSAGLQFPKERSSRRPANRARFVPAPTRPSPLHPYCFCFEGGGSMLSPQRVA
AAASRGADEKALASILLQDHIRDLDVVVVSVAGAFRKGKSFILDFMLRYLYSQKESGHSN
WLGDPEEPLTGFSWRGGSDPETTGIQIWSEVFTVEKPGGKKVAVVLMDTQGAFDSQSTVK
DCATIFALSTMTSSVQIYNLSQNIQEDDLQQLQLFTEYGRLAMDEIFQKPFQTLMFLVRD
WSFPYEYSYGLQGGMAFLDKRLQIKEPVYTMHRNCRRKLWANLLEESSYLCPYTRLQVAT
SPDFDGKLKDIAGEFKEQLQVLIPYVLNPSKLMEKEINGSKVTCRGLLEYFKAYIKIYQG
EDLPHPKSMLQATAEANNLAAAASAKDIYYNNMEEVCGGEKPYLSPDILEEKHCEFKQLA
LDHFKKTKKMGGKDFSFRYQQELEEEIKELYENFCKHNGSKNVFSTFRTPAVLFTGIVAL
YIASGLTGFIGLEVVAQLFNCMVGLLLIALLTWGYIRYSGQYRELGGAIDFGAAYVLEQA
SSHIGNSTQATVRDAVVGRPPQVKKAQ
Download sequence
Identical sequences ENSMMUP00000007625 ENSMMUP00000007625 9544.ENSMMUP00000007625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]