SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007710 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007710
Domain Number 1 Region: 232-398
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-41
Family SPRY domain 0.00029
Further Details:      
 
Domain Number 2 Region: 20-79
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000259
Family B-box zinc-binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007710   Gene: ENSMMUG00000005851   Transcript: ENSMMUT00000008199
Sequence length 404
Comment pep:known chromosome:MMUL_1:15:22747110:22769604:-1 gene:ENSMMUG00000005851 transcript:ENSMMUT00000008199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAEGAELGPGSGPGPGPEPGPLCPEHGQALSWFCRSERRPVCAACAGLGGRCRGHRIRR
AEERAEELRNKIVDQCERLQLQSAAITKYVADVLPGKNQRAVSMASAARELVIQRLSLVR
SLCESEEQRLLEQVHGEEERAHQSILTQRVHWAEALQKLDTIRTSLVGMLTHLDDLQLIQ
KEQEIFERTEEAEGILDPQESEMLNFNEKCTRSPLLTRLWATAVLGSLSGTEDIRIDERT
VSPFLQLSDDRKTLTFSTKKSKTCADGPERFDHWPNALAATSFQNGLHAWMVNVQNSCAY
KVGVASGHLPRKGSGSDCRLGHNAFSWVFSRYDQEFRFSHNGQHEPLGLLRGPAQLGVLL
DLQARELLFYEPASGTVLYTHHGSFPGPLFPVFAVADQTISIVR
Download sequence
Identical sequences A0A2K6D4H4 F7GY94
XP_001101669.1.72884 XP_011748636.1.29376 ENSMMUP00000007710 ENSMMUP00000039719 9544.ENSMMUP00000039719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]