SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007769 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007769
Domain Number 1 Region: 321-483,892-1071
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 3.79e-124
Family Mammalian PLC 0.00000721
Further Details:      
 
Domain Number 2 Region: 643-757
Classification Level Classification E-value
Superfamily SH2 domain 5.92e-31
Family SH2 domain 0.00000152
Further Details:      
 
Domain Number 3 Region: 545-661
Classification Level Classification E-value
Superfamily SH2 domain 4.98e-27
Family SH2 domain 0.00042
Further Details:      
 
Domain Number 4 Region: 1090-1211
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.27e-25
Family PLC-like (P variant) 0.002
Further Details:      
 
Domain Number 5 Region: 790-851
Classification Level Classification E-value
Superfamily SH3-domain 2.1e-19
Family SH3-domain 0.0000267
Further Details:      
 
Domain Number 6 Region: 26-141
Classification Level Classification E-value
Superfamily PH domain-like 3.52e-19
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Domain Number 7 Region: 154-314
Classification Level Classification E-value
Superfamily EF-hand 0.000000437
Family Calmodulin-like 0.034
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000007769
Domain Number - Region: 485-523
Classification Level Classification E-value
Superfamily PH domain-like 0.000189
Family Pleckstrin-homology domain (PH domain) 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007769   Gene: ENSMMUG00000005905   Transcript: ENSMMUT00000008266
Sequence length 1291
Comment pep:known chromosome:MMUL_1:10:23281971:23320281:-1 gene:ENSMMUG00000005905 transcript:ENSMMUT00000008266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGAASPCANGCGPGAPSDAEVLHLCRSLEVGTVMTLFYSKKSQRPERKTFQVKLETRQI
TWSRGADKIEGAIDIREIKEIRPGKTSRDFDRYQEDPAFRPDQSHCFVILYGMEFRLKTL
SLQATSEDEVNMWIKGLTWLMEDTLQAPTPLQIERWLRKQFYSVDRNREDRISAKDLKNM
LSQVNYRVPNMRFLRERLTDLEQRSGDITYGQFAQLYRSLMYSAQKTMDLPFLEASTLRA
GERPELCRVSLPEFQQFLLDYQGELWAVDRLQVQEFMLSFLRDPLREIEEPYFFLDEFVT
FLFSKENSVWNSQLDAVCPDTMNNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMG
CRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLQTIKEHAFVASEYPVILSIEDHCSIA
QQRNMAQHFKKVLGDTLLTKPVEISADGLPSPNQLKRKILIKHKKLAEGSAYEEVPTSMM
YSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEVSS
STELHSNEKWFHGKLGAGRDGRHIAERLLTEYCIETGAPDGSFLVRESETFVGDYTLSFW
RNGKVQHCRIHSRQDAGTPKFFLTDNLVFDSLYDLITHYQQVPLRCNEFEMRLSEPVPQT
NAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCRVQQE
GQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYGALYEGRNP
GFYVEANPMPTFKCAVKALFDYKAQREDELTFTKSAIIQNVEKQEGGWWRGDYGGKKQLW
FPSNYVEEMVNPVALEPEREHLDENSPLGDLLRGVLDVPACQIAIRPEGKNNRLFVFSIS
MASVAHWSLDVAADSQEELQDWVKKIREVAQTADARLTEGKIMERRKKIALELSELVVYC
RPVPFDEEKIGTERACYRDMSSFPETKAEKYVNKAKGKKFLQYNRLQLSRIYPKGQRLDS
SNYDPLPMWICGSQLVALNFQTPDKPMQMNQALFMTGRHCGYVLQPSTMRDEAFDPFDKS
SLRGLEPCAISVEVLGARHLPKNGRGIVCPFVEIEVAGAEYDSTKQKTEFVVDNGLNPVW
PAKPFHFQISNPEFAFLRFVVYEEDMFSDQNFLAQATFPVKGLKTGYRAVPLKNNYSEDL
ELASLLIKIDIFPAKQENGDLSPFSGTSLRERGSDASGQLFHGRAREGSFESRYQQPFED
FRVSQEHLADHFDSRERRAPRRTRVNGDNRL
Download sequence
Identical sequences A0A2K5X8C7 F6WWF3
ENSMMUP00000007769 ENSMMUP00000007769 9544.ENSMMUP00000007769 XP_005569061.1.63531 XP_011764995.1.29376 XP_015004490.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]