SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007841 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007841
Domain Number 1 Region: 359-561
Classification Level Classification E-value
Superfamily Kelch motif 8.37e-30
Family Kelch motif 0.0016
Further Details:      
 
Domain Number 2 Region: 72-198
Classification Level Classification E-value
Superfamily POZ domain 3.35e-27
Family BTB/POZ domain 0.0027
Further Details:      
 
Domain Number 3 Region: 593-659
Classification Level Classification E-value
Superfamily Kelch motif 0.000000000915
Family Kelch motif 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007841   Gene: ENSMMUG00000005962   Transcript: ENSMMUT00000008346
Sequence length 708
Comment pep:known chromosome:MMUL_1:16:51952596:51965265:-1 gene:ENSMMUG00000005962 transcript:ENSMMUT00000008346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAVAAAAAAAAAASLQVLEMESMETAAAGSAGLAAEVRGSGTVDFGPGPGISAMEAS
GGDPGPEAEDFECSSHCSELSWRQNEQRRQGLFCDITLCFGGAGGREFRAHRSVLAAATE
YFTPLLSGQFSESRSGRVEMRKWSSEPGPEPDTVEAVIEYMYTGRIRVSTGSVHEVLELA
DRFLLIRLKEFCGEFLKKKLHLSNCVAIHSLAHMYTLSQLALKAADMIRRNFHKVIQDEE
FYTLPFHLIRDWLSDLEITVDSEEVLFETVLKWVQRNAEERERYFEELFKLLRLSQMKPT
YLTRHVKPERLVANNEVCVKLVADAVERHALRAENIQSGTCQHPTSHVSLLPRYGQNMDV
IMVIGGVSEGGDYLSECVGYFVDEDRWVNLPHIHNHLDGHAVAVTESYVYVAGSMEPGFA
KTVERYNPNLNTWEHVCSLMTRKHSFGLTEVKGKLYSIGGHGNFSPGFKDVTVYNPELDK
WHNLESAPKILRDVKALAIEDRFVYIAARTPVDRDTEDGLKAVITCYDTETRQWQDVESL
PLIDNYCFFQMSVVNSNFYQTASCCPKSYCLENEEAVRKIASQVSDEILESLPPEVLSIE
GAAICYYKDDVFIIGGWKNSDDIDKQYRKEAYRYCAERKRWMLLPPMPQPRCRATACHVR
IPYRYLHGTQRYPMPQNLMWQKDRIRQMQEIHRHALNMRRVPSSQIEC
Download sequence
Identical sequences A0A024R1T8 A0A2K5W6Q2 A0A2K6BW40 G1RK16 H2QD08 Q9NVR0
ENSMMUP00000007841 gi|8922528|ref|NP_060613.1| ENSP00000314608 ENSP00000457872 ENSP00000314608 ENSP00000457872 9544.ENSMMUP00000007841 9606.ENSP00000314608 ENSNLEP00000013573 ENSP00000314608 NP_060613.1.87134 NP_060613.1.92137 XP_001107943.1.72884 XP_003279499.1.23891 XP_003813904.1.60992 XP_005584265.2.63531 XP_008010879.1.81039 XP_011723441.1.29376 XP_016787287.1.37143 ENSNLEP00000013573 ENSMMUP00000007841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]