SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007842 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007842
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily Citrate synthase 9.94e-31
Family Citrate synthase 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007842   Gene: ENSMMUG00000005963   Transcript: ENSMMUT00000008347
Sequence length 132
Comment pep:known chromosome:MMUL_1:16:51969181:51974428:-1 gene:ENSMMUG00000005963 transcript:ENSMMUT00000008347 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IMGIGHRVKSINNPDMRVQILKDYVRQHFPATPLLDYALEVEKITTSKKPNLILNVDGLI
GVAFVDMLRNCGSFTREEADEYIDIGALNGIFVLGRSMGFIGHYLDQKRLKQGLYRHPWD
DISYVLPEHMSM
Download sequence
Identical sequences G7PUT4 Q3YAQ8
ENSMMUP00000007842 9544.ENSMMUP00000007842 ENSMMUP00000007842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]