SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007859 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007859
Domain Number 1 Region: 239-450
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.62e-59
Family Reprolysin-like 0.00048
Further Details:      
 
Domain Number 2 Region: 927-977
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000034
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Domain Number 3 Region: 1559-1618
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000942
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Domain Number 4 Region: 1448-1511
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000131
Family TSP-1 type 1 repeat 0.007
Further Details:      
 
Domain Number 5 Region: 1509-1560
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000562
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number 6 Region: 859-925
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000589
Family TSP-1 type 1 repeat 0.0048
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000007859
Domain Number - Region: 1398-1453
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000183
Family TSP-1 type 1 repeat 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007859   Gene: ENSMMUG00000010716   Transcript: ENSMMUT00000008364
Sequence length 1676
Comment pep:known chromosome:MMUL_1:7:57879570:57934240:-1 gene:ENSMMUG00000010716 transcript:ENSMMUT00000008364 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGGPSPRSPAPLLRPLLLLLCALVPGAPGPAPGRATEGRAALDIVHPVRVDAGGSFLSY
ELWPRALRKRDVSVRRDAPAFYQLQYRGRELRFNLTANQHLLAPGFVSETRRRGGLGRAH
IQAHTPACHLLGEVQDPELEGGLAAISACDGLKGVFQLSNEDYFIEPLDGAPARPGHAQP
HVVYKRQVPERLAQWGDSSAPSTCGVQVSPELEPRRERWEQRQQWQRPRLRRLHQRSVSK
EKWVETLVVADAKMVEYHGQPQVESYVLTIMNMVAGLFHDPSIGNPIHITIVRLVLLEDE
EEDLKITHHADNTLKSFCKWQKSINMKGDTHPLHHDTAILLTRKDLCAAMNRPCETLGLS
HVAGMCQPHRSCSINEDTGLPLAFTVAHELGHSFGIQHDGSGNDCEPVGKRPFIMSPQLL
YDAAPLTWSRCSRQYITRFLDRGWGLCLDDPPAKDIIDFPSVPPGVLYDVSHQCRLQYGA
YSAFCEDMDNVCHTLWCSVGTTCHSKLDAAVDGTRCGENKAQRAGGVCAQGYPVMQAGGP
VSTPSLGLSQCPLGLLLTPSSPVCSLADSYQPSRSLQHVGAAWEPLACYGCVSQRVFLVA
STLLPQLLLMALLFGPPVNPCELHCRPSNEYFAEKLRDAVVDGTPCYQVRASRDLCINGI
CKNVGCDFEIDSGAMEDRCGVCHGNGSTCHTVSGTFEEAEGLGMGTGQIPSKARKPMLSN
TAVFIYFILFEMESHPRQVPRGGWNRQGFFVSGRKFQVHSPSWRDLKLTGPQPHWGWVWD
RQLRGGTTYSQDHGAGGGAEKTEPPAEGWQMVPWSPLTSLGQRVQRQSVYCSERQTGPVD
EEHCDPLGRPDDRQRKCSELPCPARWWAGEWQLCSSSCGPWGLSHRAVLCIRSVGLDEQS
ALEPLACEHLPRPPTETPCNRHVPCPATWAVGNWSQCSVTCGEGTQHRNVLCTNDTGVPC
DEAQQPASEVTCSLPPCRWPLDTLGPEGSGSGSSSHELFNEADFIPRHLAPRPSPVSSPK
PATMGNAIEEEALELDLPGPVFVDDFYYDYNFINFHEDLSYGPSEGPDLDLAETGDQTPP
PHSGPAVPSTGSPVPATEPPAAKEEGAPGPWSPSPWPSQAGHSPPPPSEQTPGNPLINFL
PEEDAPRGAPDLGLPSLPWPRVSIDGLQTPAAPESQNDFPVGKDSQSQLPPPWRDRTNEV
FKDDEEPEGHGAPHPPLRPSPTLPPLSLPPLSPVGSTHSSPSPDVTELWTGGTVAWEPTL
EGGLGPVDSELWPTVGVAPPPPPPIAHLPEMKGRDSPLEPRTPTFPTPGPGLWDVQTVAV
WGTFLPTTLTGLGHTPEPALNPGPKGQPESLSPEVPLSSRLLSTPAWDSPANSHRTPETQ
PLAPSLAEAVSPADPLAVRNASWQAGNWSQARCSTTCGLGAVWRSVRCSSGRDEDCAPAG
RPQPARRCHLRPCATWHSGNWSKCSRSCGGGSSVRDVQCVDTRDLRLLRPFHCQPGPAKP
PAHRPCGAQPCLSWYTSSWRECSEACGGGEQQRLVTCPEPGLCEEALRPNTTRPCNTHPC
TQWVVGPWGQCSAPCGGGVQRRLVKCVNTQTGLPEEDSDQCGHEAWPESSRPCGTEDCEP
VELPRCERDRLSFGFCERLRLLGRCQLPTIRMQCCRSCSPPSHGIPSRGHQRVARR
Download sequence
Identical sequences 9544.ENSMMUP00000007859 ENSMMUP00000007859 ENSMMUP00000007859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]