SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007926 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000007926
Domain Number - Region: 424-459
Classification Level Classification E-value
Superfamily UBA-like 0.085
Family CUE domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007926   Gene: ENSMMUG00000006038   Transcript: ENSMMUT00000008437
Sequence length 581
Comment pep:known chromosome:MMUL_1:7:17891863:18086531:-1 gene:ENSMMUG00000006038 transcript:ENSMMUT00000008437 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDIIKGNLDGISKPASNSRIRPGSRSSNASLEVLSTEPASCKVDTASNLNSGKEDHSESS
NTENRRTSNDDKRESCSEKIKLAEEGSDEDLDLVQRQIIPECSDEHKLEELDSQLQDAIQ
KMKKLDKILAKKQRREKEIKKQGLEMRIKLWEEIKSAKYSEAWQSKEEMENTKKFLSLTA
ASEETVGPSHENEDNFSSVFHTQIPPEEYEKQMQKLSKDFTCDVERNESLIKAGKKPFSN
TEKIELRGKHNQDFIKRNIELAKESRNPVVMIEREKKRLVELLKDLDEKDSGLSSSEGDQ
SGWVVPVKGYALAVTQHQQLAEIDIKLQELSAASPAISSFSPRLENQNNQEPDLDGEKNM
EVTPGEKVLRNTKEQRDLRIRLREIDEKLRMMKENVLQSTSRLSEEQLKCLLDECIVKQK
SIIKLSSERENEDIEDVIPMFPQLSRSIISKLLNESGTKVQKTEAEDADMLESAEREASK
GYYLTKALTGHRMSEALVTEVENMKCLQFSKNDIISDTKDYFMSKTLGIGRLKRPSFLDD
PLYGITVSLSSEDQHLKLNSPEKTKADEQETKDAAEECKEP
Download sequence
Identical sequences A0A2K6BWX8 F6WIX2
ENSMMUP00000007926 ENSMMUP00000007926 9544.ENSMMUP00000007926 XP_001092473.1.72884 XP_011757991.1.29376 XP_011757996.1.29376 XP_011758005.1.29376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]