SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007965 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007965
Domain Number 1 Region: 173-343
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.26e-50
Family Protein kinases, catalytic subunit 0.0000122
Further Details:      
 
Domain Number 2 Region: 74-211
Classification Level Classification E-value
Superfamily SH2 domain 1.18e-34
Family SH2 domain 0.00000336
Further Details:      
 
Domain Number 3 Region: 11-95
Classification Level Classification E-value
Superfamily SH3-domain 2e-18
Family SH3-domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007965   Gene: ENSMMUG00000006065   Transcript: ENSMMUT00000008477
Sequence length 362
Comment pep:known chromosome:MMUL_1:10:802840:809296:1 gene:ENSMMUG00000006065 transcript:ENSMMUT00000008477 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSRDQAHLGPKYVGLWDFKARTDEELSFRAGDVFHVARKEEQWWWATLLDEAGGAVAQG
YVPHSYLAERETVESEPWFFGCISRSEAVRLLQAEGNAAGTFLIRVSEKPGANYVLSVRD
AQAVRHYKIWWRAGGQLHLNEAVSFPSLSELVNYHRAQSLSHGLRLAAPCRKHEPEPLPH
WDDWERPREEFTLCRKLGSGYFGEVFEGLWKDRVQVAIKVISRDNLLHQQTLQSEIQAMK
KLRHKHILALYAVVSVGDPVYIITELMGKGSLLELLRDSDKKVLPVSELLDIAWQVAEGM
CYLESQNYIHRDLAARNILVGENTLCKVGDFGLARLIKEDVYLSHDRNIPYKDGPEALSR
GH
Download sequence
Identical sequences 9544.ENSMMUP00000007965 ENSMMUP00000007965 ENSMMUP00000007965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]