SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007969 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007969
Domain Number 1 Region: 220-482
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.73e-76
Family Protein kinases, catalytic subunit 0.00000017
Further Details:      
 
Domain Number 2 Region: 115-249
Classification Level Classification E-value
Superfamily SH2 domain 2.29e-34
Family SH2 domain 0.0003
Further Details:      
 
Domain Number 3 Region: 40-164
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000578
Family SH3-domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007969   Gene: ENSMMUG00000006067   Transcript: ENSMMUT00000008481
Sequence length 488
Comment pep:known chromosome:MMUL_1:10:793038:799417:1 gene:ENSMMUG00000006067 transcript:ENSMMUT00000008481 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPFLRRRLAFLSFFWDKIWPAGGEPDHGTPGSTDPGADPVPALPAEPCSPFPQLFLALY
DFAARRGEELSVRRGDRLCALEEGGGFIFARRLSGQPSAGLVPITHVAKASPETLSDQPW
YFSGVSRTQAQQLLLSPPNAPGAFLIRPSESSLGGYSLSVRAQAKVCHYRVSMAADGSLY
LQKGRLFPGLEELLTYYKANWKLIQNPLLQPCVRQKAPRQDAWERPHSEFALGRKLGEGY
FGEVWEGLWLGSLPVAIKVIKSADMKLADLAKEIQTLKGLRHERLIRLHAVCSGGEPVYI
VTELMRKGNLQVFLGSPEGRALRLPPLLGFACQVAEGMNYLEGQRIVHRDLAARNVLVDD
GLACKVADFGLARLLKDDIYSPSSGSKIPVKWTAPEAASYRVFSQKSDVWSFGVLLYEVF
TYGQCPYEGMTNHETLQQIMRGYRLPRPAACPAEVYVLMLECWRSSPEERPSFATLWEKL
HAIHRCLP
Download sequence
Identical sequences ENSMMUP00000007969 ENSMMUP00000007969 9544.ENSMMUP00000007969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]