SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007986 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007986
Domain Number 1 Region: 819-1107
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.91e-82
Family Protein kinases, catalytic subunit 0.0000000000406
Further Details:      
 
Domain Number 2 Region: 449-636
Classification Level Classification E-value
Superfamily Fibronectin type III 2.29e-17
Family Fibronectin type III 0.0036
Further Details:      
 
Domain Number 3 Region: 638-733
Classification Level Classification E-value
Superfamily Fibronectin type III 4.66e-16
Family Fibronectin type III 0.003
Further Details:      
 
Domain Number 4 Region: 370-448
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000596
Family I set domains 0.042
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000007986
Domain Number - Region: 220-336
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00298
Family Growth factor receptor domain 0.0082
Further Details:      
 
Domain Number - Region: 132-219
Classification Level Classification E-value
Superfamily Immunoglobulin 0.017
Family I set domains 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007986   Gene: ENSMMUG00000006080   Transcript: ENSMMUT00000008498
Sequence length 1124
Comment pep:known chromosome:MMUL_1:15:49863956:49985532:-1 gene:ENSMMUG00000006080 transcript:ENSMMUT00000008498 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSLASLVLCGVSLLLSGTVEGAMDLILINSLPLVSDAETSLTCIASGWHPHEPITIGRD
FEALMNQHQDPLEVTQDVTREWAKKVVWKREKASKINGAYFCEGRVRGEAIRIRTMKMRQ
QASFLPATLTMTVDKGDNVNISFKKVLIKEEDAVIYKNGSFIHSVPRHEVPDILEVHLPH
AQPQDAGVYSARYIGGNLFTSAFTRLIVRRCEAQKWGPECNRLCTVCVNNGVCHEDTGEC
ICPPGFMGRTCEKACERHTFGRTCKERCSGQDGCKSYVFCLPDPYGCSCATGWKGLQCNE
ACHHGFYGPDCKLRCSCSNGETCDRFQGCLCSPGRQGLQCEREGIPRMTPKIVDLPDHIE
VNSGKFNPICKASGWPLPTNEEMTLVKPDGTVLHPKDFNHTDHFSVAIFTIHRILPPDSG
VWVCSANTVAGMVEKPFNISVKVLPKPLNAPNVIDTGHNFAVINISSEPYFGDGPIKSKK
LLYKPVNHYEAWRHIQVTNEIVTLNHLEPRTEYELCVQLVRRGEGGEGHPGPVRRFTTAS
IGLPPPRGLNLLPKSQTTLNLTWQPIFPSSEDDFYVEVERRSVQKSDQQNIKVPGNLTSV
LLNNLHPREQYVVRARVNTKAQGEWSEDLTAWTLSDILPPQPENIKISNITHSSAVISWT
ILDGYSISSITIRYKVQGKNEDQHIDVKIKNATITQYQLKGLEPETAYQVDIFAENNIGS
SNPAFSHELVTLPESEAPADLGGGKMLLIAILGSAGMTCLTVLLAFLIILQLKRANVQRR
MAQAFQNVREEPAVQFNSGTLALNRKVKNNPDPTIYPVLDWNDIKFQDVIGEGNFGQVLK
ARIKKDGLRMDAAIKRMKEYASKDDHRDFAGELEVLCKLGHHPNIINLLGACEHRGYLYL
AIEYAPHGNLLDFLRKSRVLETDPAFAIANSTASTLSSQQLLHFAADVARGMDYLSQKQF
IHRDLAARNILVGENYVAKIADFGLSRGQEVYVKKTMGRLPVRWMAIESLNYSVYTTNSD
VWSYGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRLEKPLNCDDEVFDLMRQCWREKPY
ERPSFAQILVSLNRMLEERKTYVNTTLYEKFTYAGIDCSAEEAA
Download sequence
Identical sequences A0A096P1E5 A0A2K6CQG2 G7NFP9 G7PS68
XP_001105270.1.72884 XP_011760117.1.29376 ENSMMUP00000007986 9544.ENSMMUP00000007986 ENSMMUP00000007986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]