SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008018 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000008018
Domain Number 1 Region: 55-168,199-334
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.21e-95
Family Motor proteins 0.0000000119
Further Details:      
 
Domain Number 2 Region: 411-735
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.58e-93
Family Motor proteins 0.00000000168
Further Details:      
 
Domain Number 3 Region: 733-858
Classification Level Classification E-value
Superfamily Myosin rod fragments 4.71e-22
Family Myosin rod fragments 0.00034
Further Details:      
 
Domain Number 4 Region: 853-969
Classification Level Classification E-value
Superfamily Myosin rod fragments 8.55e-21
Family Myosin rod fragments 0.001
Further Details:      
 
Domain Number 5 Region: 1139-1246
Classification Level Classification E-value
Superfamily Myosin rod fragments 1.31e-17
Family Myosin rod fragments 0.0028
Further Details:      
 
Domain Number 6 Region: 957-1047
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000222
Family Myosin rod fragments 0.0037
Further Details:      
 
Domain Number 7 Region: 1246-1347
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000000115
Family Myosin rod fragments 0.01
Further Details:      
 
Domain Number 8 Region: 1656-1757
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00004
Family Regulator of G-protein signaling, RGS 0.0081
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000008018
Domain Number - Region: 1323-1445
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00017
Family Myosin rod fragments 0.0057
Further Details:      
 
Domain Number - Region: 1725-1820
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00462
Family Myosin rod fragments 0.017
Further Details:      
 
Domain Number - Region: 27-60
Classification Level Classification E-value
Superfamily Myosin S1 fragment, N-terminal domain 0.0369
Family Myosin S1 fragment, N-terminal domain 0.0016
Further Details:      
 
Domain Number - Region: 1055-1127
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0994
Family Myosin rod fragments 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008018   Gene: ENSMMUG00000006101   Transcript: ENSMMUT00000008531
Sequence length 1857
Comment pep:known chromosome:MMUL_1:10:80182656:80248752:-1 gene:ENSMMUG00000006101 transcript:ENSMMUT00000008531 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQQAADKYLYVDKNFINNPLAQADWAAKKLVWVPSDKSGFEPASLKEEVGEEAIVELVE
NGKKVKVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGLFCVV
INPYKNLPIYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQGGHIWCHIDLVAGDGQC
IMEVCRPLYESQGQWLSRGHGELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFD
VNGYIVGANIETYLLEKSRAIRQAKEERTFHIFYYLLSGAGEHLKTDLLLEPYNKYRFLS
NGHVTIPGQQDKDMFQETMEAMRIMGIPEEEQMGTGLAFLWGRVETTVMDPWEKVSAAAW
ASFFINEKYSMVLLGSALPTLCGIQWILMSGLWLLEGRGAPPRVCSPVLMLCFLQAGPPG
ILALLDEECWFPKATDKSFVEKVMQEQGTHPKFQKPKQLKDKADFCIIHYAGKVDYKADE
WLMKNMDPLNDNIATLLHQSSDKFVSELWKDVDRIIGLDQVAGMSETALPGAFKTRKGMF
RTVGQLYKEQLAKLMATLRNTNPNFVRCIIPNHEKKAGKLDPHLVLDQLRCNGVLEGIRI
CRQGFPNRVVFQEFRQRYEILTPNSIPKGFMDGKQACVLMIKALELDSNLYRIGQSKVFF
RAGVLAHLEEERDLKITDVIIGFQACCRGYLARKAFAKRQQQLTAMKVLQRNCAAYLKLR
NWQWWRLFTKVKPLLQVSRQEEEMMAKEEELVKVREKQLAAENRLTEMETLQSQLMAEKL
QLQEQLQAETELCAEAEELRARLTAKKQELEEICHDLEARVEEEEERCQHLQTEKKKMQQ
NIQELEEQLEEEESARQKLQLEKVTTEAKLKKLEEEQIILEDQNCKLAKEKKLLEDRIAE
FTTNLTEEEEKSKSLAKLKNKHEAMITDLEERLRREEKQRQELEKTRRKLEGDSTDLSDQ
IAELQAQIAELKMQLAKKEEELQAALARVEEEAAQKNMALKKIRELESQISELQEDLESE
RASRNKAEKQKRDLGEELEALKTELEDTLDTTAAQQELRSKREQEVNILKKTLEEEAKTH
EAQIQEMRQKHSQAVEELAEQLEQTKRVKANLEKAKQTLENERGELANEVKVLLQGKGDS
EHKRKKVEAQLQELQVKFNEGERVRTELADKVTKLQVELDNVTGLLSQSDSKSSKLTKDF
SALESQLQDTQELLQEENRQKLSLSTKLKQVEDEKNSFREQLEEEEEAKHNLEKQIATLH
AQVADMKKKMEDSVGCLETAEEVKRKLQKDLEGLSQRHEEKVAAYDKLEKTKTRLQQELD
DLLVDLDHQRQSACNLEKKQKKFDQLLAEEKTISAKYAEERDRAEAEAREKETKALSLAR
ALEEAMEQKAELERLNKQFRTEMEDLMSSKDDVGKSVHELEKSKRALEQQVEEMKTQLEE
LEDELQATEDAKLRLEVNLQAMKAQFERDLQGRDEQSEEKKKQLVRQVREMEAELEDERK
QRSMAVAARKKLEMDLKDLEAHIDSANKNREEAIKQLRKLQAQMKDCMRELDDTRASREE
ILAQAKENEKKLKSMEAEMIQLQEELAAAERAKRQAQQERDELADEIANSSGKGALALEE
KRRLEARIAQLEEELEEEQGNTELINDRLKKANLQIDQINTDLNLERSHAQKNENARQQL
ERQNKELKVKLQEMEGTVKSKYKASITALEAKIAQLEEQLDNETKERQAACKQVRRTEKK
LKDVLLQVDDERRNAEQYKDQADKASTRLKQLKRQLEEAEEEAQRANASRRKLQRELEDA
TETADAMNREVSSLKNKLRRGDLPFVMPRRMARKGAGDGSDEEVDGKADGAEAKPAE
Download sequence
Identical sequences ENSMMUP00000008018 ENSMMUP00000008018 9544.ENSMMUP00000008018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]