SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008029 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000008029
Domain Number - Region: 44-114
Classification Level Classification E-value
Superfamily Chromo domain-like 0.00742
Family Chromo domain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008029   Gene: ENSMMUG00000006111   Transcript: ENSMMUT00000008542
Sequence length 260
Comment pep:known chromosome:MMUL_1:X:102218766:102231562:-1 gene:ENSMMUG00000006111 transcript:ENSMMUT00000008542 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRSKMRGASSGKKTAGPQQKNLEPALPGRWGGRSAENPPSVSVRKTRKNKQKTPGNGDG
GSTSEAPQPPRKKRARADPTVESEEAFKNRMEVKVKIPEELKPWLVEDWDLVTRQKQLFQ
LPAKKNVDAILEEYANCKKSQGNVDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYA
EILLAHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLGYLHDFLKYLAKNSA
SLFTASDYKVASAEYHRKAL
Download sequence
Identical sequences ENSMMUP00000008029 ENSMMUP00000008030 ENSMMUP00000040897 9544.ENSMMUP00000040897 ENSMMUP00000008029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]