SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008045 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000008045
Domain Number 1 Region: 375-432
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000392
Family TSP-1 type 1 repeat 0.0046
Further Details:      
 
Domain Number 2 Region: 199-256
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000112
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 
Domain Number 3 Region: 257-313
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000012
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 4 Region: 436-487
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000575
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 5 Region: 317-370
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000811
Family TSP-1 type 1 repeat 0.0055
Further Details:      
 
Domain Number 6 Region: 146-196
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000275
Family TSP-1 type 1 repeat 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008045   Gene: ENSMMUG00000006118   Transcript: ENSMMUT00000008558
Sequence length 538
Comment pep:known chromosome:MMUL_1:7:50378792:50427668:1 gene:ENSMMUG00000006118 transcript:ENSMMUT00000008558 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFTYKRPNEISSTAGESFLAEGPTNEILDVYMIHQQPNPGVHYEYVIMGTNAISPQVPPH
RRPGDPFNGQLVTEGRSQEEGEEKGRNEEKEDLRGEAPEMFTSESAQTFPVRHPDRFSPR
RPDNLVPPAPQLPRRSRDHNWKQLGTTECSTTCGKGSQYPIFRCVHRSTHEEAPESYCDS
SMKPTPEEEPCNIFPCPAFWDIGEWSECSKTCGLGMQHRQVLCRQVYANRSLTVQPYRCQ
HLEKPETTSTCQLKICSEWQIRTDWTSCSVPCGVGQRTRDVKCVSNIGDVVDDEECNMKL
RPNDIENCDMGPCAKSWFLTEWSERCSAECGAGVRTRSVVCMTNHVSSLPLEGCGNNRPA
EATPCDNGPCTGKVEWFAGSWSQCSIECGSGTQQREVICVRKNADTFEVLDPSECSFLEK
PPSQQSCHLKPCGAKWFSTEWSMCSKSCQGGFRVREVRCLSDDMTLSNLCDPQLKPEERE
SCNPQDCVPEVDENCKDKYYNCNVVVQARLCVYNYYKTACCASCTRVANRQTGFLGSR
Download sequence
Identical sequences F7B086 G7P911
9544.ENSMMUP00000008045 ENSMMUP00000008045 ENSMMUP00000008045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]