SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008130 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000008130
Domain Number 1 Region: 1853-1965
Classification Level Classification E-value
Superfamily Bromodomain 4.19e-36
Family Bromodomain 0.00015
Further Details:      
 
Domain Number 2 Region: 532-659
Classification Level Classification E-value
Superfamily DNA-binding domain 4.25e-22
Family Methyl-CpG-binding domain, MBD 0.018
Further Details:      
 
Domain Number 3 Region: 1719-1790
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.08e-18
Family PHD domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008130   Gene: ENSMMUG00000006182   Transcript: ENSMMUT00000008650
Sequence length 1968
Comment pep:known chromosome:MMUL_1:12:22860440:22993683:-1 gene:ENSMMUG00000006182 transcript:ENSMMUT00000008650 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQTKSTSSGGGNRKCNQEQSKNQPLDARVDKIKDKKPRKKAMESSSNSDSDSGTSSDTS
SEGISSSDSDDLEEDEEEEDQSIEESEDDDSDSESEAQHKSNNQVLLHGISDPKADGQKA
TEKAQEKRIHQPLPLVSESQTHSSFQSQQKQPQVLSQQLPFIFQSSQAKEESVNKHTSVI
QSTGLVSNVKPLSLVNQAKKETYMKLIVPSPDVLKAGNKNTSEESSSLTSELRSKREQYK
QAFPSQLKKQESSKSLKKVIAALSNPKATSSSPAHPKQILENNHPNPFLTNALLGNHQPN
GVIQSVIQEAPLALTTKTKMQSKINENIAAASSTPFSSPVNLSTSGRRTPGNQTPVMPSA
SPILHSQGKEKAVSNNVNPVKTQRHSHPAKPLVEQFRGTDSDIPSSKDSEDSNEDEEEDD
EEEDEEDDEDDESDDSQSESDSNSESDTEGSEEEDDDDKDQDESDSDTEGEKTSMKLNKT
TSSVKSPSMSLTAHSTPRNLHIAKAPGSAPAALCSESQLPAFLGTSSSTLTSSPHSGTSK
RRRVTDERELRIPLEYGWQRETRIRNFGGRLQGEVAYYAPCGKKLRQYPEVIKYLSRNGI
MDISRDNFSFSAKIRVGDFYEARDGPQGMQWCLLKEEDVIPRIRAMEGRRGRPPNPDRQR
AREESRMRRRKGRPPNVGNAEFLDNTDAKLLRKLQAQEIARQAAQIKLLRKLQKQEQARV
AKEAKKQQAIMAAEEKRKQKEQIKIMKQQEKIKRIQQIRMEKELRAQQILEAKKKKKEEA
ANAKLLEAEKRIKEKEMRRQQAVLLKHQERERRRQHMMLMKAMEARKKAEEKERLKQEKR
DEKRLNKERKLEQRRLELEMAKELKKPNEDMCLADQKPLPELPRIPGLVLSGSTFSDCLM
VVQFLRNFGKVLGFDVNIDVPNLSVLQEGLLNIGDSMGEVQDLLVRLLSAAVCDPGLITG
YKAKTALGEHLLNVGVNRDNVSEILQIFMEAHCGQTELTESLKTKAFQAHTPAQKASVLA
FLINELACSKSVVSEIDKNIDYMSNLRRDKWVVEGKLRKKSYFIKVNVLFSFYTNFQIDN
AQFRWDIKLIKLRGRICNSYDDDDDDDSDDQGDEDDEDEEDKEDKGKKTDTCEDEDEGDQ
AASVEELEKQIEKLSKQQSQYRRKLFDASHSLRSVMFGQDRYRRRYWILPQCGGIFVEGM
ESGEGLEEIAKEREKLKKAESVQIKEEMFETSGDSLNCSNTDHCEQKEDLKEKDNTNLFL
QKPGSFSKLSKLLEVAKMPPESEVITPKPNAGANGCTLSYQNSGKHSLGSVQSTATQSNV
EKADSNNLFNTGSSGPGKFYSPLPSDQLLKTLTEKNRQWFSLLPRTPCDDTSLTHADMST
ASLVTPQSQPPSKSPSPAPAPLGSSTQNPVGLNPFALSPLQVKGGVSMMGLQFCGWPTGV
LTSNIPFASSVPGLGSGLGLSEGNGNSLLTSTVASSKSESPVPQNEKATSAQPAAVEVAK
PVDFPSPKPIPEEMQFGWWRIIDPEDLKALLKVLHLRGIREKALQKQIQKHLDYITQACI
KNKDVAIIELNENEENQVTRDIVENWSVEEQAMEMDLSVLQQVEDLERRVASASLQVKGW
MCPEPATEREDLVYFEHKSFTKLCKEHDGEFTGEEESSAHALERKSDNPLDIAVTRLADL
ERNIERRIEEDIAPGLRVWRRALSEARSAAQVALCIQQLQKSIAWEKSIMKVYCQICRKG
DNEELLLLCDGCDKGCHTYCHRPKITTIPDGDWFCPACIAKASGQTLKIKKLHVKGKKTN
ESKKGKKVTLTGDTEDEDSASTSSSLKRGNKDLKKRKMEENTSINLSKQESFTSVKKPKR
DDSKDLALCSMILTEMETHEDAWPFLLPVNLKLVPGYKKVIKKPMDFSTIREKLSSGQYP
NLETFALDVRLVFDNCETFNEDDSDIGRAGHNMRKYFEKKWTDTFKVS
Download sequence
Identical sequences 9544.ENSMMUP00000008130 ENSMMUP00000008130 ENSMMUP00000008130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]