SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008164 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000008164
Domain Number 1 Region: 519-683
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000696
Family SPRY domain 0.029
Further Details:      
 
Domain Number 2 Region: 50-211
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000712
Family SPRY domain 0.088
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000008164
Domain Number - Region: 724-881
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0127
Family SPRY domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008164   Gene: ENSMMUG00000006207   Transcript: ENSMMUT00000008687
Sequence length 1072
Comment pep:known chromosome:MMUL_1:16:7051443:7065206:-1 gene:ENSMMUG00000006207 transcript:ENSMMUT00000008687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGSGGSGGSGGGPGPGPGGGGGPSGSGSGPGSNGGLGSGGELHPRTGRLVSLSACGRT
ARRQQPGQEFNHGLVLSREPLRDGRIFTVRIDRKVNSWSGSIEIGVTALDPSVLDFPSSA
TGLKGGSWVVSGCSVLRDGRSVLEEYGQDLDQLGEGDRVGVERTVAGELRLWVNGRDCGV
AATGLPPRVWAVVDLYGKCTQITVLPPEPGFSPPTPIPTPPLEPLAPTEDSALAEQGTSA
DEAFMVSPAQARPETFPNSLESHNDFASMELSEVVSNTILSTYNGGLLNVNLSSPPAGEG
LGSSGAATSPILTSNDALLFHEKCGTLIKLSNNNKTAERRRPLDEFNNGVVMTNRPLRDN
EMFEIRIDKLVDKWSGSIEIGVTTHNPNSLEYPATMTNLQSGTIMMSGCGILTNGKGTRR
EYCEFSLDELQEGDHIGLTRKSNSALHFFINGIDQGVATPLTPPVVYGVVDLYGMAVKVT
IVHNNNHSDRLRRNNAILRALSPEGALRRAAPAAQAEPERLLFHPNCGQKAAITHEGRTA
LRPHATDDFNHGVVLSSRALRDGEVFQVRIDKMVDKWAGSIEIGVTTHNPAYLQLPSTMT
NLRSGTWMMTGNGVMHNGTTILDEYGHNLDRLKAGDTVGVVRREDGTLHFFVNGMTQGPA
AWNVPPGVYAVVDLYGQAAQATIVDDVEVSPVPESLPEGNNQVSPSSPSSGAGGSDLRFH
QLHGSNAVITNGGRTALRHNCRSEFNDAIVISNRALRDGELFEIVIQKMVDRWSGSIEAG
VTAIRPEDLEFPNTMTDIDYDTWMLSGTAIMQDGNTMRNNYGCDLDALGTGARIGMMRTA
KGDLHYFINGQDQGAACSGLPPEVYAVVDLYGQCVQVSITNATGPMDNSLATSNTATEKS
FPLHSPVAGVAHRFHSTCGKNVTLEEDGTRAVRAAGYAHGLVFSTKELRAEEVFEVKVEE
LDEKWAGSLRLGLTTLAPGEMGPGAGGSGPGLPPSLPELRTKTTWMVSSCEVRRDGQLQR
MNYGRNLERLGVGSRVGVRRGADDTMHILVDGEDMGPAATGIAKNVWAVLDF
Download sequence
Identical sequences ENSMMUP00000008164 ENSMMUP00000008164 9544.ENSMMUP00000008164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]