SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008220 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000008220
Domain Number 1 Region: 584-818
Classification Level Classification E-value
Superfamily Ribonuclease H-like 8.09e-73
Family PIWI domain 0.054
Further Details:      
 
Domain Number 2 Region: 36-387
Classification Level Classification E-value
Superfamily PAZ domain 2.2e-72
Family PAZ domain 0.000000236
Further Details:      
 
Domain Number 3 Region: 369-523
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0000759
Family PIWI domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008220   Gene: ENSMMUG00000006251   Transcript: ENSMMUT00000008747
Sequence length 858
Comment pep:known chromosome:MMUL_1:1:38724329:38766008:1 gene:ENSMMUG00000006251 transcript:ENSMMUT00000008747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAGPSGAAAGAYLPPLQQVFQAPRRPGIGTVGKPIKLLANYFEVDIPKIDVYHYEVDIK
PDKCPRRVNREVVEYMVQHFKPQIFGDRKPVYDGKKNIYTVTALPIGNERVDFEVTIPGE
GKDRIFKVSIKWLAIVSWRMLHEALVSGQIPVPLESVQALDVAMRHLASMRYTPVGRSFF
SPPEGYYHPLGGGREVWFGFHQSVRPAMWKMMLNIDVSATAFYKAQPVIEFMCEVLDIRN
IDEQPKPLTDSQRVRFTKEIKGLKVEVTHCGQMKRKYRVCNVTRRPASHQTFPLQLESGQ
TVECTVAQYFKQKYNLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQTS
TMIKATARSAPDRQEEISRLMKNASYNLDPYIQEFGIKVKDDMTEVTGRVLPAPILQYGG
RNRAIATPNQGVWDMRGKQFYNGIEIKVWAIACFAPQKQCREEVLKNFTDQLRKISKDAG
MPIQGQPCFCKYAQGADSVEPMFRHLKNTYSGLQLIIVILPGKTPVYGTVLLGQTLLSVA
PWGLLGRTQSRVLALTRASGYWMVPAREDPTPHHFVFSSLLSSAVFQQPVIFLGADVTHP
PAGDGKKPSITAVVGSMDAHPSRYCATVRVQRPRQEIIEDLSYMVRELLIQFYKSTRFKP
TRIIFYRDGVPEGQLPQILHYELLAIRDACIKLEKDYQPGITYIVVQKRHHTRLFCADKN
ERIGKSGNIPAGTTVDTNITHPFEFDFYLCSHAGIQGTSRPSHYYVLWDDNRFTADELQI
LTYQLCHTYVRCTRSVSIPAPAYYARLVAFRARYHLVDKEHDSGEGSHISGQSNGRDPQA
LAKAVQVHQDTLRTMYFA
Download sequence
Identical sequences 9544.ENSMMUP00000008220 ENSMMUP00000008220 ENSMMUP00000008220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]