SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008239 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000008239
Domain Number 1 Region: 279-551
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.29e-74
Family Protein kinases, catalytic subunit 0.000000000915
Further Details:      
 
Domain Number 2 Region: 168-308
Classification Level Classification E-value
Superfamily SH2 domain 6.33e-38
Family SH2 domain 0.00000248
Further Details:      
 
Domain Number 3 Region: 108-193
Classification Level Classification E-value
Superfamily SH3-domain 3.28e-20
Family SH3-domain 0.0000381
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008239   Gene: ENSMMUG00000006262   Transcript: ENSMMUT00000008766
Sequence length 1182
Comment pep:known chromosome:MMUL_1:1:191598608:191632093:1 gene:ENSMMUG00000006262 transcript:ENSMMUT00000008766 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQQVGRVGEAPGLQQPQPRGIRGSNCARAEENRLNPGGRGCKTGFHHVGQANHFASCVE
DGFEGDKTGGSSPEALHRPYGCDVEPQALNEAIRWSSKENLLGATESDPNLFVALYDFVA
SGDNTLSITKGEKLRVLGYNQNGEWSEVRSKNGQGWVPSNYITPVNSLEKHSWYHGPVSR
SAAEYLLSSLINGSFLVRESESSPGQLSISLRYEGRVYHYRINTTADGKVYVTAESRFST
LAELVHHHSTVADGLVTTLHYPAPKCNKPTVYGVSPIHDKWEMERTDITMKHKLGGGQYG
EVYVGVWKKYSLTVAVKTLKVACSSLTLEHFPPTGAKHISKFTILQFLGVCTLEPPFYIV
TEYMPYGNLLDYLRECNREEVTAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGEN
HVVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNTFSIKSDVWAFGVLLWEIAT
YGMSPYPGIDLSQVYDLLEKGYRMEQPEGCPPKVYELMRACWKWSPADRPSFAETHQAFE
TMFHDSSISEEVAEELGRAASSSSVVPYLPRLPILPSKTRTLKKQVENKENIEGAQDATE
NSASSLAPGFVRGAQASSGSPALPRKQRDKSPSSLLEDAKETCFTRDRKGGFFSSFMKKR
NAPTPPKRSSSFREMENQPHKKYELTGNFSSVASLQHADGFSFTPAQQEANLVPPKCYGG
SFAQRNLCNDDGGGGGGSGTAGGGWSGITGFFTPRLIKKTLGLRAGKPTASDDTSKPFPR
SNSTSSMSSGLPEQDRMAMTLPRNCQRSKLQLERTVSTSSQPEENVDRANDMLPKKSEEG
AAPSRERPKAKLLPRGATALPLRTPSGDLAITEKDPPGVGVSGVAAAPKGKEKNGGARLG
MAGVLEDGEQPGWPSPAKAAPVLPTTHNHKVPVLISPTLKHTPADVQLIGTDSQGNKFKL
LSEHQVTSSGDKDRPRRVKPKCAPPPPPVMRLLQHPSICSDPTEEPTAPTAGQSTSETQE
GGKKAALGAVPVGGKAGRPVMPPPQVPLPTSSISPAKMANGTAGTKVALRKTKQAAEKIS
ADKISKEALLECADLLSSAITEPVPNSQLVDTGHQLLDYCSGYVDCIPQTRNKFAFREAV
SKLELSLQELQVSSAAAGVPGANPVLNNLLSCVQEISDVVQR
Download sequence
Identical sequences ENSMMUP00000037795 ENSMMUP00000008239 9544.ENSMMUP00000037795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]