SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008391 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000008391
Domain Number 1 Region: 21-300
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 8.89e-69
Family FCH domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008391   Gene: ENSMMUG00000006359   Transcript: ENSMMUT00000008923
Sequence length 320
Comment pep:known chromosome:MMUL_1:14:24939977:24945430:1 gene:ENSMMUG00000006359 transcript:ENSMMUT00000008923 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPEEDAGGEALGGSFWEAGNYRRTVQRVEDGHRLCGDLVSCFQERARIEKAYAQQLADW
ARKWRGTVEKGPQYGTLEKAWHAFFTAAERLSALHLEVREKLQGQDSERVRAWQRGAFHR
PVLGGFRESRAAEDGFRKAQKPWLKRLKEVEASKKSYHAARKDEKTAQTRESHAKADSAV
SQEQLRKLQERVERCAKEAEKTKAQYEQTLAELHRYTPRYMEDMEQAFETCQAAERQRLL
FFKDMLLTLHQHLDLSSSEKFHELHRDLHQGIEAASDEEDLRWWRSTHGPGMAMNWPQFE
ALVLGHTEDNQSEREGWPEP
Download sequence
Identical sequences ENSMMUP00000008391 ENSMMUP00000008391 9544.ENSMMUP00000008391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]