SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008452 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000008452
Domain Number 1 Region: 295-480
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-66
Family SPRY domain 0.00000499
Further Details:      
 
Domain Number 2 Region: 5-83
Classification Level Classification E-value
Superfamily RING/U-box 1.65e-22
Family RING finger domain, C3HC4 0.0068
Further Details:      
 
Domain Number 3 Region: 89-153
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000229
Family B-box zinc-binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008452   Gene: ENSMMUG00000022682   Transcript: ENSMMUT00000008991
Sequence length 485
Comment pep:known chromosome:MMUL_1:14:69103206:69111319:1 gene:ENSMMUG00000022682 transcript:ENSMMUT00000008991 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPTALVEAIVEEVACPICMTFLREPVSIDCGHSFCHSCLSGLWEIPGESQNWGYTCPLC
RAPVQPRNLRPNWQLANVVEKVRLLRLHPGMGLKGDLCECHGEKLKMFCKEDVLIMCEAC
SQSPEHEAHSVVPMEDVAWEYKWELHEALEHLKKEQEEAWKLEVGERKRTATWKAEVETR
KQSIVWEFEKYQRLLEKKQPPHRQLEAEVTAALASLQQEAAETMQKLELNHSELIQQSRV
LWRMIAELKERSQRPVRWMLQDIQEVLNRSKSWSLQRPEPISLELKTDCRVLGLREILKT
YAADVHLDPDTAYSRLIVSEDRKRVHYGDTNQKLPDNPERFYRYNIVLGSQCISSGRHYW
EVEVGDRSEWGLGVCKQNVDRKEVVYLSPHYGFWVIRLRKGNEYRAGTDEYPLLSLPVPP
RRVGIFVDYEAHDISFYNVTDYGSHIFTFPRYPFPGRLLPYFSPCYSIGTNNTAPLAICS
LDGED
Download sequence
Identical sequences ENSMMUP00000008452 ENSMMUP00000008452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]