SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008522 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000008522
Domain Number - Region: 528-613
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0942
Family FCH domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008522   Gene: ENSMMUG00000006466   Transcript: ENSMMUT00000009070
Sequence length 706
Comment pep:known chromosome:MMUL_1:11:27197612:27208152:-1 gene:ENSMMUG00000006466 transcript:ENSMMUT00000009070 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIFSESHKTVFVVDHCPYMAESCRQHVEFDMLVKNRTQGIIPLAPISKSLWTCSVESSM
EYCRIMYDIFPFKKLVNFIVSDSGAHVLNSWTQEDQNLQELMAALAAVGPPNPRADPECC
SILHGLVAAVETLCKITEYQHEARTLLMENAERVGNRGRIICITNAKSDSHVRMLEDCVQ
ETIHEHNKLAANSDHLMQIQKCELVLIHTYPVGEDSLVSDRSKKELSPVLTSEVHSVRAG
RHLATKLNILVQQHFDLASTTITNIPMKEEQHANTSANYDVELLHHKDAHVDFLKSGKRH
LKVLFSPISSGKTFQEPQWMPETSDGLEPYTVYTVFSYTYIPMINFITDSVILFLTGRSV
LLEQPRKSGSKVISHMLSSHGGEIFLHVLSSSRSILEDPPSISEGCGGRVTDYRITDFGE
FMRENRLTPFLDPRYKIDGSLEVPLERAKDQLEKHTRYWPMIISQTTIFNMQAVVPLASV
IVKESLTEEDVLNCQKTIYNLVDMERKNDPLPISTVGTRGKGPKRDEQYRIMWNELETLV
RAHINNSEKHQRVLECLMACRSKPPEEEERKKRGRKREDKEDKSEKAVKDYEQEKSWQDS
ERLKGILERGKEDLAEAEIIKDSPDSPEPPNKKPLVEMDETPQVEKSKGPVSLLSLWSNR
INTANSRKHQEFAGRLNSVNNRAELYQHLKEENGMETTENGKASRQ
Download sequence
Identical sequences ENSMMUP00000008523 9544.ENSMMUP00000008523 ENSMMUP00000008522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]