SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008601 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000008601
Domain Number 1 Region: 285-375
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 6.98e-29
Family SWIB/MDM2 domain 0.0000046
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000008601
Domain Number - Region: 411-464
Classification Level Classification E-value
Superfamily Virus ectodomain 0.0222
Family Virus ectodomain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008601   Gene: ENSMMUG00000006531   Transcript: ENSMMUT00000009154
Sequence length 515
Comment pep:known chromosome:MMUL_1:11:47211127:47226145:1 gene:ENSMMUG00000006531 transcript:ENSMMUT00000009154 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARAGFQSVAPSGGAGASGGAGAAAALGPGGTPGPPVRMGPAPGQGLYRSPMPGAAYPR
PGMLPGSRMTPQGPSMGPPGYGGNPSVRPGLAQSGMDQSRKRPAPQQIQQVQQQAVQNRN
HNAKKKKMADKILPQRIRELVPESQAYMDLLAFERKLDQTIMRKRLDIQEALKRPIKQKR
KLRIFISNTFNPAKSDAEDGEGTVASWELRVEGRLLEDSALSKYDATKQKRKFSSFFKSL
VIELDKDLYGPDNHLVEWHRTATTQETDGFQVKRPGDVNVRCTVLLMLDYQPPQFKLDPR
LARLLGIHTQTRPVIIQALWQYIKTHKLQDPHEREFVICDKYLQQIFESQRMKFSEIPQR
LHALLMPPEPIIINHVISVDPNDQKKTACYDIDVEVDDTLKTQMNSFLLSTASQQEIATL
DNKIHETIETINQLKTQREFMLSFARDPQGFINDWLQSQCRDLKTMTDVVGNPEEERRAE
FYFQPWAQEAVCRYFYSKVQQRRQELEQALGIRNT
Download sequence
Identical sequences A0A096NFJ9 A0A1S3A2Y8 A0A1S3FCF0 A0A250Y299 A0A2I2UTR2 A0A2I3S359 A0A2J8SY71 A0A2K5D8M9 A0A2K5HS32 A0A2K5KQF8 A0A2K5RTH8 A0A2K5X7U0 A0A2K5Y944 A0A2K6E8W4 A0A2K6GQ64 A0A2K6MQ23 F7FF65 F7HTY2 Q96GM5
NP_001231542.1.46622 NP_003067.3.87134 NP_003067.3.92137 XP_002752491.1.60252 XP_003988729.1.62641 XP_004274390.1.21590 XP_004400894.1.74151 XP_007452348.1.90284 XP_007528547.1.11023 XP_008138884.1.99482 XP_008510752.1.77740 XP_010988000.1.51371 XP_012296736.1.9421 XP_012509345.1.63892 XP_012874283.1.60039 XP_014439576.1.99106 XP_017401308.1.71028 XP_019274861.1.44245 XP_019274862.1.44245 XP_019517878.1.44202 XP_020033540.1.5219 XP_021560602.1.83697 ENSMMUP00000008602 ENSPANP00000011700 ENSP00000378414 GO.34880 HR4789 ENSPTRP00000008410 9544.ENSMMUP00000008602 9598.ENSPTRP00000008410 9606.ENSP00000378414 gi|133908629|ref|NP_003067.3| ENSPTRP00000008410 ENSFCAP00000008775 ENSMMUP00000008601 ENSCJAP00000039244 ENSCJAP00000039238 ENSP00000378414 ENSP00000370924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]