SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008614 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000008614
Domain Number 1 Region: 220-407
Classification Level Classification E-value
Superfamily NTF2-like 6.13e-60
Family TIM44-like 0.0000000533
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008614   Gene: ENSMMUG00000006542   Transcript: ENSMMUT00000009168
Sequence length 415
Comment pep:known chromosome:MMUL_1:19:7982213:7997283:1 gene:ENSMMUG00000006542 transcript:ENSMMUT00000009168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRPGGELPLSKSYSSGNRKGFLSGLLDNVKQELAKNKEMKESIKKFRDEARRLEESDVL
QEARRKYKTIESETMRTSEVLRKKLGELTGTVKESLHEVSKSDLGRKIKEGVEEAAKTAK
QSAESVSKGGEKLGRTAAFRALSQGVESVKKEIDDSVLGQTGPYRRPQRLRKRTEFSGEK
FKEEKVFEPNEEALGVVLHKDSKWYQQWKDFKENNVVFNRFFEMKMKYDESDNAFIRASR
ALTDKVTDLLGGLFSKTEMSEVLTEILRVDPAFDKDRFLKQCENDIIPNVLEAMISGELD
ILKDWCYEATYSQLAYPIQQAKALGLQFHSRILDIDNIDLAMGKMMEPGPVLIITFQAQL
VVVVRNPKGEVVEGDPDKVLRMLYVWALCRDQDELNPYAAWRLLDISASSTEQIL
Download sequence
Identical sequences G7NN87
9544.ENSMMUP00000008614 ENSMMUP00000008614 ENSMMUP00000008614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]