SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008623 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000008623
Domain Number 1 Region: 732-899
Classification Level Classification E-value
Superfamily ADP-ribosylation 7.29e-38
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.025
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000008623
Domain Number - Region: 597-690
Classification Level Classification E-value
Superfamily WWE domain 0.00301
Family WWE domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008623   Gene: ENSMMUG00000006550   Transcript: ENSMMUT00000009177
Sequence length 908
Comment pep:known chromosome:MMUL_1:3:176544757:176562871:-1 gene:ENSMMUG00000006550 transcript:ENSMMUT00000009177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADPEVCCFITKILCAHGGRMALDALLEEIALSEPQLCEVLQVAGPDRFVVLETSGEAGI
TRSVVATTRARVCRRKYCQRPCDNLHLCKLNLLGRCNYSQSERNLCKYSHEVLSEENFRV
LKNHELSGLNKEELAVLLLQSDPFFMPEICKNYKGEGRQQICNQQPPCSRLHICDHFTRG
NCRFPNCLRSHNLMDRKVLAIMREHGLNPDVVQNIQDICNSKHMQKNPPGPRAPSSHRRN
MAYRARSKSRDRFFQGSQEFLASASASAERSCTPSPDPSSHRASLEDTPVDDLTHKFTYL
GSQDRARPPSGSSKATDLGGTSQAGASRRFFENGSQEDLLHGNPGNTYLASNSTPAPKWK
SPTSWTNDQGARRKTVFPPTLPAALSSLGSLQTPEAVTTRKGAGLLSSDYRNINGKSGTQ
DVQPGPLFNNNADGVATDTTSTRSLNYKSTSSSQREISTPRTQDAGPASRDVQATGRITD
DAGPRVALVNDKTTDVEKTGATGFGFTMAVMVEKDKLRSGKSPLNSSCSKVHFHLPYRWQ
MFIGETWTDFKPMEMIEEAYSDPRIHVCSVGSYTINFREMSCDFIPIRRLSTPSSVTKPA
NSVFTTKWIWYWKNESGTWIQYGEEVSTRHCSVMLVRPEKNTSYSGPHGRNPSFSRTDLD
YFIYFFLSKGMIQTNKASKTQKDVIRRPKFVSQWDVQQMKRGPDRQPAQTSSVSLTATFL
PQEDLCFLSSNKYKLSEIHHLHPEYVKVSEHFKASMKNFKIEKIKKIENLELLDKFTRKK
SQMKEEGSLLFYATSRAYVESICANNFDWTLHETHETKYGKGYYFAKDAIYSHKNCPYDA
KNIVMFVARVLVGNFIEGNVSYMSPPQPYNSFVDTRLNPSVFVIFEKDQIYPQYVIEYTD
ADKACVIS
Download sequence
Identical sequences ENSMMUP00000008623 ENSMMUP00000008624 9544.ENSMMUP00000008624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]