SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008723 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000008723
Domain Number 1 Region: 612-979
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 8.89e-129
Family Hect, E3 ligase catalytic domain 0.00000000368
Further Details:      
 
Domain Number 2 Region: 63-165
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.28e-23
Family Synaptotagmin-like (S variant) 0.01
Further Details:      
 
Domain Number 3 Region: 216-258
Classification Level Classification E-value
Superfamily WW domain 0.0000000000000473
Family WW domain 0.001
Further Details:      
 
Domain Number 4 Region: 555-594
Classification Level Classification E-value
Superfamily WW domain 0.0000000000000746
Family WW domain 0.00024
Further Details:      
 
Domain Number 5 Region: 391-429
Classification Level Classification E-value
Superfamily WW domain 0.000000000000163
Family WW domain 0.0016
Further Details:      
 
Domain Number 6 Region: 509-543
Classification Level Classification E-value
Superfamily WW domain 0.000000000000415
Family WW domain 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008723   Gene: ENSMMUG00000006616   Transcript: ENSMMUT00000009284
Sequence length 986
Comment pep:known chromosome:MMUL_1:18:51591254:51624162:1 gene:ENSMMUG00000006616 transcript:ENSMMUT00000009284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGWLRGALPGRERLQSPPHAVPPSRLLVTWQGAGRDQDFSSPPPLLLLGETDHLHLDLPL
SPLPTSDELFLPGICDPYVKLSLYVADENRELALVQTKTIKKTLNPKWNEEFYFRVNPSN
HRLLFEVFDENRLTRDDFLGQVDVPLSHLPTEDPTMERPYTFKDFLLRPRRAPEQGDGHT
GLLLAALPKNQPQNHPSHFIPQHGWEVVDSNDSASQHQEELPPPPLPPGWEEKVDNLGRT
YYVNHNNRTTQWHRPSLMDVSSESDNNIRQINQEAAHRRFRSRRHISEDLEPEPSEGGDV
PEPWETISEEVNIAGDSLGLALPPPPASPGSRTSPQELSEELSRRLQITPDSNGEQFSSL
VQREPSSRLRSCSVTDAVAEQGHLPPPSVAYVHTTPGLPSGWEERKDAKGRTYYVNHNNR
TTTWTRPIVQLAEDGASGSATNSNNHLIEPQIRRPRSLSSPTVTLSAPLEGAKDSPVRRA
VKDTLSNPQSPQPSPYNSPKPQHKVTQSFLPPGWEMRIAPNGRPFFIDHNTKTTTWEDPR
LKFPVHMRSKTSLNPNDLGPLPPGWEERIHLDGRTFYIDHNSKITQWEDPRLQNPAITGP
AVPYSREFKQKYDYFRKKLKKPADIPNRFEMKLHRNNIFEESYRRIMSVKRPDVLKARLW
IEFESEKGLDYGGVAREWFFLLSKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSY
FTFIGRVAGLAVFHGKLLDGFFIRPFYKMMLGKQITLNDMESVDSEYYNSLKWILENDPT
ELDLMFCIDEENFGQTYQVDLKPNGSEIMVTNENKREYIDLVIQWRFVNRVQKQMNAFLE
GFTELLPIDLIKIFDENELELLMCGLGDVDVNDWRQHSIYKNGYCPNHPVIQWFWKAVLL
MDAEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQLFTIEQWGSPEKLPRAHTCFNRLDLP
PYETFEDLREKLLMAVENAQGFEGVD
Download sequence
Identical sequences 9544.ENSMMUP00000008721 ENSMMUP00000008721 ENSMMUP00000008723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]