SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008799 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000008799
Domain Number 1 Region: 253-343
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 1.55e-26
Family SWIB/MDM2 domain 0.0000227
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008799   Gene: ENSMMUG00000006687   Transcript: ENSMMUT00000009365
Sequence length 483
Comment pep:known chromosome:MMUL_1:3:188188282:188224554:-1 gene:ENSMMUG00000006687 transcript:ENSMMUT00000009365 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAADEVAGGARKATKSKLFEFLVHGVRPGMPSGARMPHQGAPMGPPGSPYMGSPAVRPGL
APAGMEPARKRAAPPPGQSQAQSQGQPVPTAPARSRSAKRRKMADKILPQRIRELVPESQ
AYMDLLAFERKLDQTIMRKRVDIQEALKRPMKQKRKLRLYISNTFNPAKPDAEDSDGSIA
SWELRVEGKLLDDPSKQKRKFSSFFKSLVIELDKDLYGPDNHLVEWHRTPTTQETDGFQV
KRPGDLSVRCTLLLMLDYQPPQFKLDPRLARLLGLHTQSRSAIVQALWQYVKTNRLQDSH
DKEYINGDKYFQQIFDCPRLKFSEIPQRLTALLLPPDPIVINHVISVDPSDQKKTACYDI
DVEVEEPLKGQMSSFLLSTANQQEISALDSKIHETIESINQLKIQRDFMLSFSRDPKGYV
QDLLRSQSRDLKVMTDVAGNPEEERRAEFYHQPWSQEAVSRYFYCKIQQRRQELEQSLVV
RNT
Download sequence
Identical sequences A0A250Y1P6 A0A2K5C1U2 A0A2K5K0K8 A0A2K5LNK7 A0A2K5V1Q0 A0A2K5ZT34 A0A2K6C460 A0A2K6GQB3 F6VWZ5 F7H1V4 G1SCX1 H0XTM9 H2QVN0 I3MDZ9 Q6STE5
ENSOGAP00000019471 ENSMMUP00000008798 ENSP00000349254 ENSP00000262188 ENSOCUP00000000217 ENSOGAP00000019471 ENSP00000262188 ENSPTRP00000034052 ENSCJAP00000037917 ENSMMUP00000008799 ENSPTRP00000034052 gi|51477702|ref|NP_001003801.1| NP_001003801.1.87134 NP_001003801.1.92137 NP_001247613.1.72884 XP_002715103.1.1745 XP_002751898.1.60252 XP_003792085.1.62490 XP_004046556.1.27298 XP_004594460.1.84141 XP_004669626.1.11716 XP_005326738.1.77405 XP_007981702.1.81039 XP_008845459.1.79516 XP_011728126.1.29376 XP_011796899.1.43180 XP_011839718.1.47321 XP_011913141.1.92194 XP_012298404.1.9421 XP_012517593.1.63892 XP_012641654.1.48125 XP_016801432.1.37143 XP_020025837.1.5219 XP_519517.3.37143 9544.ENSMMUP00000008798 9606.ENSP00000262188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]