SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008855 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000008855
Domain Number 1 Region: 422-543
Classification Level Classification E-value
Superfamily Bromodomain 4.97e-37
Family Bromodomain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008855   Gene: ENSMMUG00000006731   Transcript: ENSMMUT00000009422
Sequence length 1484
Comment pep:known chromosome:MMUL_1:10:62040279:62225892:1 gene:ENSMMUG00000006731 transcript:ENSMMUT00000009422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCPEEGGAAGLGELRSWWEVPAIAHFCSLFRTAFRLPDFEIEELEAALHRDDVEFISDLI
ACLLQGCYQRRDITPQTFHSYLEDIINYRWELEEGKPNPLREASFQDLPLRTRVEILHRL
CDYRLDADDVFDLLKGLDADSLRVEPLGEDNSGALYWYFYGTRMYKEDPVQGKSNGELSL
SRESEGQKNVSSIPGKTGKRRGRPPKRKKLQEEILLSEKQEDNSLASEPQTRHGSQGPGQ
GTWWLLCQTEEEWRQVTESFRERTSVRERQLYKLLSEDFLPEICNMIAQKGKRPQRTKAE
LHPRWMSDHLSIKPIKQEETPVLTRIEKQKRKEEEEERQILLAVQKKEQEQMLKEERKRE
LEEKVKAVEGMCSDRVVWRGACLWTSHPPVYRAKRRKLREERAWLLAQGKELPPELSHLD
PNSPMREEKKTKDLFELDDDFTAMYKVLDVVKAHKDSWPFLEPVDESYAPNYYQIIKAPM
DISSMEKKLNGGLYCTKEEFVNDMKTMFRNCRKYNGESSEYTKMSDNLERCFHRAMMKHF
PGEDGDTDEEFWIREDEKREKRRSRAGRSGGSHVWTRSRDPEGPSRKQQPVENGGKSLPP
TRRAPSSGDEQSSSSAQPAREVGTSNGRGFSHPLHCGGTPSQAPFLNQMRPAVPGTFGPL
RGSDPATLYGSGVPEPHPGEPVQQRQPFAMQPPVGINSLRGPRLGTPEEKQMCGGLTHLS
NMGPHPGSLQLGQISGPSQDGSVYAPAQFQPGFIPPRHGGAPPRPPDFPESSEMAPSHMY
RSYKYLNRVHSAVWNGNHGATNPGPLGPDEKPHLGPGPSHQPRTLGPMMDSRVMRPPVPH
NQWTEQSGFLPHGAPSTGYLRPPCKSAGHRLQPPPVPAPSSLFGAPAQALRGLQGGDSMM
DSPEMIAMQQLSSRVCPPGVPYHPQQPAPPRLPGPFPQVAHAVSVTVSAPKPALGNPGRA
PNSETQEPENDQAEPLPGLEEKPASVGTSEGIYLKQLPHPTPPLQTDCTRQSSPQERETV
GPELKSNSSESADSCKATKGKNPWPSDSSYPGPAAQGCMRDLSTVADRGTLPENGVTGEA
SPCGSEGKGLGSSGSEKLLCPRGRTFQETMPCTGQNATTPPSTDPGLMGGTVSQFSPLYV
PGLEYPNSAAHYHISPGLQGVGAVMGGKSPASHPQHFPPRGFQSNHAHSGGFPRYRPPQG
MRYSYHPPPQPSYHHYQRTPYYACPQSFSDWQRPLHPQGSPGGPPASQPPPPRSLFSDKN
AMASLQGCETLHAALTSPTRMDAVAAKVPNDGQNPGPEEEKLDESLERPESPKEFLDLDN
HNAATKRQSSLSASEYLYGTPPPPLSSGMGFASSAFPPHGVMLQPGPPYTPQRPASHFQP
RAYSSPVAAHPPHHPGATQPNGLSQEGPIYRCQEEGLGHFQAVMMEQIGTRSGIRGPFQE
MYRPSGMQMHPVQSQASFPKTPTAATSQEELPPHKPPTLPLDQV
Download sequence
Identical sequences ENSMMUP00000008855 ENSMMUP00000008858 9544.ENSMMUP00000008858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]