SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008941 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000008941
Domain Number 1 Region: 262-413,442-488
Classification Level Classification E-value
Superfamily TPR-like 4.11e-25
Family Tetratricopeptide repeat (TPR) 0.0027
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000008941
Domain Number - Region: 100-144
Classification Level Classification E-value
Superfamily N-terminal coiled coil domain from apc 0.00301
Family N-terminal coiled coil domain from apc 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008941   Gene: ENSMMUG00000006803   Transcript: ENSMMUT00000009515
Sequence length 635
Comment pep:known chromosome:MMUL_1:7:167012366:167052891:1 gene:ENSMMUG00000006803 transcript:ENSMMUT00000009515 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTMVYIKEDKLEKLTQDEIISKTKQVIQGLEALKNEHNSILQSLLETLKCLKKDDESNL
VEEKSNMIRKSLEMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDEL
ANTQQKLQKSEQSVAQLEEEKKHLEFMNQLKKYDDDISPSEDKDTDSTKEPLDDLFPNDE
DDPGQGSDSQQSVAASVHAACLEEAPAEQGCLWFSKIICAMMPPHSSLCNRVRLRLRKKK
KSCSDLHLKHLSKTLNVVFPFRDQNKYKDAANLLNDALAIREKTLGKDHPAVAATLNNLA
VLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEYYYQR
ALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGSVDDENK
PIWMHAEEREECKGKQKDGTSFGEYGGWYKACKVDSPTVTTTLKNLGALYRRQGKFEAAE
TLEEAAMRSRKQGLDNVHKQRVAEVLNDPENMEKRRSRESLNVDVVKYESGPDGGEEVSM
SVEWNGDGTGSLKRSGSFSKLRASIRRSSEKLVRKLKGGSSRESEPKNPGMKRASSLNVL
NVGGKAAEDRFQGVSGRASFCGKRQQQQWLGRRHR
Download sequence
Identical sequences ENSMMUP00000032540 ENSMMUP00000008941 9544.ENSMMUP00000032540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]