SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008994 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000008994
Domain Number 1 Region: 2-41,70-133
Classification Level Classification E-value
Superfamily Doublecortin (DC) 1.2e-21
Family Doublecortin (DC) 0.015
Further Details:      
 
Domain Number 2 Region: 517-579
Classification Level Classification E-value
Superfamily Doublecortin (DC) 0.000000000000196
Family Doublecortin (DC) 0.0052
Further Details:      
 
Domain Number 3 Region: 270-374
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.000000000105
Family Ricin B-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008994   Gene: ENSMMUG00000006842   Transcript: ENSMMUT00000009571
Sequence length 683
Comment pep:known chromosome:MMUL_1:14:40843578:40876737:1 gene:ENSMMUG00000006842 transcript:ENSMMUT00000009571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKPICKTTEPYAPVRLRVLRNGDKNRNRSLTILGPDISPGWKTQSVHTEKKEKICVTKY
SETEMDQIEFHQFLERCTEILNLPSAARRLYNEKGKEIFALKDLQRDELVYVSCGEHWIN
PDLSIAQQKKQIFLRNLASDISKIEIFCSIHKIEALVLEVQSDIVSGSKLAVHKPVAIFG
EEKQVTEPEEKQMQKDALTTENASSEILDSHARAHLRMKACHTLLRYAWQKASHDFDEDD
SLPKKMEKGLFENVEPQKKYSCSPKHSKLHKHCHQQFEYRDGQIISLAAPQLVLGVQGPS
LRSGMEVVLVEKKSDGSNQRWIHQEDSRTFHLVSNPDLVLAVSMTKTGNEVCGYPVIVQK
YKPYNNGAANQKWRYMKDIKALVAFHSTALDKEITSANYAGVCTSSVIKEENIDQPGYYY
LSPDGKRKTMLCLACGQSMRTEKGLKQLLPGVPFLCISGTKTQKPFLQGPFKVISVAEVD
LSCDEAEKTLSYYQARLLSLRMKTCTQAASHSGMAATHQKAVKIIAYKNGDGYRNGKLIV
AGTFPMLLTECTEKLGLARAASKVYTKDGTPIFTLRDLVLWALDDSFLQRDSEKQKQDAA
PVGKEQIIVQKNLRMKVKNRLFPKSVTSDSLDGIDKSLLTLILRNPIAIWVSSGEPFLPP
NGNFAESRKIRETELAEKGQNSG
Download sequence
Identical sequences ENSMMUP00000008994 9544.ENSMMUP00000037064 ENSMMUP00000037064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]