SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009006 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009006
Domain Number 1 Region: 200-320
Classification Level Classification E-value
Superfamily EF-hand 1.75e-36
Family Osteonectin 0.01
Further Details:      
 
Domain Number 2 Region: 289-381
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 3.27e-28
Family Thyroglobulin type-1 domain 0.0008
Further Details:      
 
Domain Number 3 Region: 129-183
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000036
Family Ovomucoid domain III-like 0.0068
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000009006
Domain Number - Region: 394-431
Classification Level Classification E-value
Superfamily ARM repeat 0.0317
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009006   Gene: ENSMMUG00000006851   Transcript: ENSMMUT00000009583
Sequence length 435
Comment pep:known chromosome:MMUL_1:5:158883833:159362267:-1 gene:ENSMMUG00000006851 transcript:ENSMMUT00000009583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKVSAVLCVCAAAWCSQSLAAAAAVAAAGGRSDGGNFLDDKQWLTTISQYDKEVGQWNK
FRDEVEDDYFRTWSPGKPFDQALDPAKDPCLKMKCSRHKVCIAQDSQTAVCISHRRLTHR
MKEAGVDHRQWRGPILSTCKQCPMVYPSPVCGSDGHTYSFQCKLEYQACVLGKQISVKCE
GHCPCPSDKPTSTSRNVERACSDLEFREVANRLRDWFKALHESGSQNKKTKTLLRTERSR
FDTSILPICKDSLGWMFNRLDTNYDLLLDQSELRSIYLDKNEQCTKAFFNSCDTYKDSLI
SNNEWCYCFQRQQDPPCQTELSNIQKRQGVKKLLGQYIPLCDEDGYYKPTQCHGSVGQCW
CVDRYGNEVMGSRINGVADCEPHSFVQAFNHGDFHEWTDDEDDEDDIMNDEDEIEDDDED
EGDDDDGGDDHDGYI
Download sequence
Identical sequences 9544.ENSMMUP00000009006 ENSMMUP00000009006 ENSMMUP00000009006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]