SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009011 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009011
Domain Number 1 Region: 68-365,396-415
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.79e-38
Family 2,6-dihydropseudooxynicotine hydrolase-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009011   Gene: ENSMMUG00000006856   Transcript: ENSMMUT00000009589
Sequence length 421
Comment pep:known chromosome:MMUL_1:7:136695359:136699992:1 gene:ENSMMUG00000006856 transcript:ENSMMUT00000009589 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSATLILEPPGRCCWNEPVRIAVRGLAPEQRVTLRASLRDEKGALFRAHARYCADARGEL
DLEHAPALGGSFAGLEPMGLLWALEPEKPFWRFLKRDVEIPFVVELEVLDGHDPEPGRLL
CQARHERLFLPPGVRRESVRAGRVRATLFLPPGPGPFPGIIDIFGIGGGLLEYRASLLAG
HGFATLALAYYNFEDLPKNMDNISLEYFEEALCYMLQHPQVKGPGIGLLGISLGADICLS
MASFLKNVSATVSINGSGISGNKAINYKLSSIPPLGYDLRRIKVAFSGLMDIVDIRNDLV
GGYENSSMIPVEKAQGPILLIVGQDDHNWRSELYAQKVSERLQAHGKEKPQIICYPGTGH
YIEPPYFPLCPASLHELVNKHVMWGGEPTAHSKAQVDAWKQILAFFCKHLGGTQKTAFPK
L
Download sequence
Identical sequences A0A2K5VEV4
ENSMMUP00000009011 XP_001091182.1.72884 XP_005561779.1.63531 ENSMMUP00000009011 9544.ENSMMUP00000009011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]