SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009050 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009050
Domain Number 1 Region: 1-208,272-334
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 1.29e-31
Family D-aminoacid oxidase, N-terminal domain 0.0000000289
Further Details:      
 
Domain Number 2 Region: 195-287
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 8.37e-24
Family D-aminoacid oxidase-like 0.00000655
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009050   Gene: ENSMMUG00000006893   Transcript: ENSMMUT00000009633
Sequence length 347
Comment pep:known chromosome:MMUL_1:11:109893548:109914041:1 gene:ENSMMUG00000006893 transcript:ENSMMUT00000009633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVVVIGAGVIGLSTALCIHERYHSVLQPLDIKVYADRFTPLTTTDVAAGFWQPYLSDPS
NPKEADWSQQTFDYLLSHIHSPNAEKLGLFLISGYNLFHEAIPDPSWKDTVLGFRKLTPR
ELDIFPDYSYGWFHTSLILEGKNYLQWLTERLTERGVKFFQRKVESFEEVAREGADVIVN
CTGVWAGVLQPDPLLQPGRGQIIKVDAPWIKHFILTHEPESGIYNSPYIIPGTQTVTLGG
IFQLGNWNELNNIQDHNTIWEGCCRLEPTLKNARIVDERTGFRPVRPKIRLEREQLRVGP
SNTEVIHNYGHGGYGLTIHWGCALEAAKLFGRILEEKKLSKMPPSHL
Download sequence
Identical sequences ENSMMUP00000009050 ENSMMUP00000009050 9544.ENSMMUP00000009050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]