SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009189 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009189
Domain Number 1 Region: 291-461
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.1e-45
Family Ribonuclease PH domain 1-like 0.0000409
Further Details:      
 
Domain Number 2 Region: 1-131
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.47e-37
Family Ribonuclease PH domain 1-like 0.00013
Further Details:      
 
Domain Number 3 Region: 132-221
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.24e-24
Family Ribonuclease PH domain 2-like 0.0019
Further Details:      
 
Domain Number 4 Region: 215-316
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 1.57e-22
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00000883
Further Details:      
 
Domain Number 5 Region: 443-549
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 4.97e-22
Family Ribonuclease PH domain 2-like 0.0002
Further Details:      
 
Domain Number 6 Region: 543-633
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000555
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009189   Gene: ENSMMUG00000007003   Transcript: ENSMMUT00000009784
Sequence length 734
Comment pep:known chromosome:MMUL_1:13:55959428:56010878:-1 gene:ENSMMUG00000007003 transcript:ENSMMUT00000009784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NRKLEISSGKLARFADGSAVVQSGDTAVMVTAVSKTKPSPSQFMPLVVDYRQKAAAAGRI
PTNYLRREIGTSDKEILTSRIIDRSIRPLFPAGYFYDTQVLCNLLAVDGINEPDVLAING
ASVALSLSDIPWNGPVGAVRIGMIDGEYVVNPTRKEMSSSTLNLVVAGAPKSQIVMLEAS
AENILQQDFCHAIKVGVKYTQQIIQGIQQLVKEIGVTKRTPQKLFTPLPEIVKHTHKLAM
ERLYAVFTDYEHEKVSRDEAINKIRLDTEEQLKEKFPEADPYEIIESFNVVAKEVFRSII
LNEYKRCDGRDLTSLRNISCEVDTFKTLHGSALFQRGQTQVLCTVTFDSLESSIKSDQVI
TAINGIKDKNFMLHYEFPPYATNEIGKVTGLNRRELGHGALAEKALYPVIPKDFPFTIRV
TSEVLESNGSSSMASACGGSLALMDSGVPISSAVAGVAIGLVTKTDPEKGEIEDYRLLTD
ILATGIEDYNGDMDFKIAGTNKGITALQADIKLPGIPIKIVMEAIQQASVAKKEILQIMN
KTISKPRASRKENGPVVETVQVPLSKRAKFVGPGGYNLKKLQAETGVTISQVDEETFSVF
APTPSAMHEARDFITEICKDDQEQQLEFGAVYTATITEISFTVLRKKCVPPLNYVIMHND
WHGFFFQIKHPTALGLEVGQEIQVKYFGRDPADGRMRLSRKVLQSPATTVVRTLNDRNSI
VMGEAISQSSSNSQ
Download sequence
Identical sequences 9544.ENSMMUP00000009189 ENSMMUP00000009189 ENSMMUP00000009189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]