SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009364 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009364
Domain Number 1 Region: 232-363
Classification Level Classification E-value
Superfamily PX domain 3.14e-27
Family PX domain 0.002
Further Details:      
 
Domain Number 2 Region: 3-72
Classification Level Classification E-value
Superfamily SH3-domain 3.94e-16
Family SH3-domain 0.0014
Further Details:      
 
Domain Number 3 Region: 389-592
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000384
Family BAR domain 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009364   Gene: ENSMMUG00000007142   Transcript: ENSMMUT00000009978
Sequence length 595
Comment pep:known chromosome:MMUL_1:4:104983828:105069782:-1 gene:ENSMMUG00000007142 transcript:ENSMMUT00000009978 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATKARVMYDFAAEPGNNELTVNEGEIITITNPDVGGGWLEGRNIKGERGLVPTDYVEIL
PSDGKDQFSCGNSVADQAFLDSLSASTARASSSAASNNHQVGSGNDPWSAWSASKSGNWE
SSEGWGAQPEGAGAQRSTNTPNNWDTAFGHPQAYQGPATGDDDDWDEDWDGPKSSSYFKD
SESADAGGSQRGNSRASSSSMKIPLNKFPGFAKPGTEQYLLAKQLAKPKEKIPIIVGDYG
PMWVYPTSTFDCVVADPRKGSKMYGLKSYIEYQLTPTNTNRSVNHRYKHFDWLYERLLVK
FGSAIPIPSLPDKQVTGRFEEEFIKMRMERLQAWMTRMCRHPVISESEVFQQFLNFRDEK
EWKTGKRKAEKDELAGVMIFSTMEPEAPDLDLVEIEQKCEAVGKFTKAMDDGVKELLTVG
QEHWKRCTGPLPKEYQKIGKALQSLATVFSSSGYQGETDLNDAITEAGKTYEEIASLVAE
QPKKDLHFLMECNHEYKGFLGCFPDIIGTHKGAIEKVKESDKLVATSKITPQDKQNMVKR
VSTMSYALQAEMNHFHSNRIYDYNSVIRLYLEQQVQFYETIAEKLRQALSRFPVM
Download sequence
Identical sequences F7DMR9
ENSMMUP00000009365 9544.ENSMMUP00000009365 ENSMMUP00000009364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]