SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009517 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009517
Domain Number 1 Region: 17-117
Classification Level Classification E-value
Superfamily BolA-like 3.4e-29
Family BolA-like 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009517   Gene: ENSMMUG00000007258   Transcript: ENSMMUT00000010138
Sequence length 137
Comment pep:known chromosome:MMUL_1:1:128252051:128253219:1 gene:ENSMMUG00000007258 transcript:ENSMMUT00000010138 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSGRLVPGLVSMAGRVCLSRGSAGSGAIGPVEAAIRTKLEQALSPEVLELRNESSGHAV
PPGSETHFRVAVVSSRFEGLSPLQRHRLVHAALAEELAGPVHALAIQARTPAQWRENSQL
DTSPPCLGGNKKALGTP
Download sequence
Identical sequences F7FGU2
9544.ENSMMUP00000009517 ENSMMUP00000009517 NP_001244490.1.72884 XP_011767453.1.29376 XP_011767454.1.29376 XP_015005986.1.72884 ENSMMUP00000009517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]