SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009543 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009543
Domain Number 1 Region: 502-598
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000221
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.03
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000009543
Domain Number - Region: 1083-1139
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 0.00863
Family C-terminal domain of PLC-beta 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009543   Gene: ENSMMUG00000007280   Transcript: ENSMMUT00000010170
Sequence length 1402
Comment pep:known chromosome:MMUL_1:1:202228504:202309166:1 gene:ENSMMUG00000007280 transcript:ENSMMUT00000010170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ERFLARPFLSTNQHLARWGSPLIQGKVQLPSQQPRHSRPSHELCSKEEKSATLPKLISLV
VSSETTDFRNKTMDSRRDRERRKRVLEGKLQLPRALARTQRARDEGRRAWTSRRPQQRRS
PESCEAPLSARLWGPRRGLPGREPLRSRSASATAFRIIGPILALLLRLLHLGFGSGGCRE
DVPPSDRGKKEEKMKKHRRALALVSCLFLCSLVWLPSWRVCCKESSSASASSYYSQDDNC
ALENEDVQFPKKNTESKKLSPPVVETLPTVDLHEESSNAVVDSETVENISSSSTSEITPI
SKLDEIEKSGTIPIAKPSETEQSETDCDVGEALDASAPIEQPSFVSPPDSLVGQHIENVS
SSHGKGKITKSEFESKVSASEQDGGDQKSALNASDNVKNESSDYTKPGDIDPTSVTSPKD
PEDIPTFDEWKKKVMEVEKEKSQSMHPSSNGGSHATKKVQKNRNNYASVECGAKILAANP
EAKSTSAILIENMDLYMLNPCSTKIWFVIELCEPIQVKQLDIANYELFSSTPKDFLVSIS
DRYPTNKWIKLGTFHGRDERNVQSFPLDEQMYAKYVKVELVSHFGSEHFCPLSLIRVFGT
SMVEEYEEIADSQYHSERQELFDEDYDYPLDYNTGEDKSSKNLLGSATNAILNMVNIAAN
ILGAKTEDLTEGNKSISENATATAAPKMPESTPVSTPVPSPAYVTTEVDTNDMELSTPDT
PKESPIVQLVQEEEEEASPSTVTLLGSGEQEDESSPWFESETQIFCSELTTICCISSFSE
YIYKWCSVRVALYWQRSRTALSKGKDYLVSAQPPLLPAESVDISVLQPLSGELENKNIER
EAETVVLGDLSSSMHQDDLVNHTVDAVELEPSHSQTLSQSLLLDITPEINPLPKIEVSES
VEYEAGHITSQVIPQESSVEIDNEAEQKSESFSSIEKPSVTYETNKVNEVVDNIIKEDVN
SMQIFTKLSETIVPPINTATVPDNEDGEAKMNVADTAKQTLISVVDSSSFPEVKEEEQSP
EDALLRGLQRTATDFYAELQNSTDLGYANGNLVHGSNQKESVFMRLNNRIKALEVNMSLS
GRYLEELSQRYRKQMEEMQKAFNKTIVKLQNTSRIAEEQDQRQTEAIQLLQAQLTNMTQL
VSNLSATVAELKREVSDRQSYLVISLVLCVVLGLMLCMQRCRNTSQFDGDYISKLPKSNQ
YPSPKRCFSSYDDMNLKRRTSFPLMRSKSLQLTGKEVDPNDLYIVEPLKFSPEKKKKRCK
YKIEKIETIKPAEPLHPIANGDIKGRKPFTNQRDFSNIGEVYHSSYKGPPSEGSSETSSQ
SEESYFCGISACTSLCNGQSQKTKTEKRALKRRRSKVQDQGKLIKTLIQTKSGSLPSLHD
IIKGNKEITVGTFGVTAVSGHI
Download sequence
Identical sequences 9544.ENSMMUP00000018073 ENSMMUP00000009543 ENSMMUP00000018073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]