SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009569 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009569
Domain Number 1 Region: 17-146
Classification Level Classification E-value
Superfamily ENTH/VHS domain 9.81e-20
Family RPR domain (SMART 00582 ) 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009569   Gene: ENSMMUG00000007303   Transcript: ENSMMUT00000010200
Sequence length 1122
Comment pep:known chromosome:MMUL_1:1:128739745:128853702:1 gene:ENSMMUG00000007303 transcript:ENSMMUT00000010200 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGGGGGSSKASSSSASSAGALESSLDRKFQSVTNTMESIQGLSSWCIENKKHHSTIVY
HWMKWLRRSAYPHRLNLFYLANDVIQNCKRKNAIIFRESFADVLPEAAALVKDPSVSKSV
ERIFKIWEDRNVYPEEMIVALREALSTTFKTQKQLKENLNKQPNKQWKKSQTSTNPKAAL
KSKIVAEFRSQALIEELLLYKRSEDQIELKEKQLSTMRVDVCSTETLKCLKDKTGGKKFS
KEFEEASSKLEEFVNGLDKQVKNGPSLTEALENAGIFYEAQYKEVKVVANAYKTFANRVN
NLKKKLDQLKSTLPDPEESPVPSPSMDAPSPTGSESPFQGMGGEESRSPTMESEKSATPE
PVTDNRDVEDMELSDVEDDASKIIVEDRKEKPAEKSAVSTSVPTKPTENISKASSCTPVP
VTVTATPPLPKPVNTSLSPSPALALPNLANVDLAKISSILSSLTSVMKNTGVSPASRPSP
GTPTSPSNLTSGLKTPAPATTTSHNSLANILSKVEITPESILSALSKTQTQSAPALQGLS
SLLQSVTGNPVPASEAASQSTSASPANTTVSTIKGRNLPSNAQPFVSKSFNYSPNSSTSE
VSSTSASKASIGQSPGLPSTTFKLPSNSLGFTATHNTSPAAPPTEVTMCQSSEVSKPKLE
SESTSPSLEMKIHNFLKGNPGFSGLNLNIPILSSLGSSAPSESHPSDFQRGPTSTSIDNI
DGTPVRDERNFEYSGPPPSAMMNLEKKPAKSILKSSKLSDTTEYQPILSSYSHRAQEFGV
KSAFPPSVRALLDSSENCDRLSSSPGLFGAFSVRGNEPGSDRSPSPSKNDSFFTPDSNHN
SLSQSTTGHLSLPQKQYPDSPHPVPHRSLFSPQNTLAAPTGHPPTSGVEKVLASTISTTS
TIEFKNMLKNASRKPSDDKHFGQAPSKGTPGDGVSLPNLTQPTLTTTDQQQQEEHYRIET
RVSSSCLDLPDSTEEKGAPIETLGYHNASNRRMSGEPIQTVESIRVPGKGNRGHGREASR
VGWFDLSTSGSSFDNGPSSASELASLGGGGSGGLTGFKTAPYKERAPQFQESVGSFRSNS
FNSTFEHHLPPSPLEHGTPKQREPVGPSSAPPVPPKDHGGIF
Download sequence
Identical sequences ENSMMUP00000009569 ENSMMUP00000009570 9544.ENSMMUP00000009570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]