SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009600 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009600
Domain Number 1 Region: 1-116
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.53e-40
Family N-terminal domain of xrcc1 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009600   Gene: ENSMMUG00000007325   Transcript: ENSMMUT00000010232
Sequence length 142
Comment pep:known chromosome:MMUL_1:14:69956266:69961835:-1 gene:ENSMMUG00000007325 transcript:ENSMMUT00000010232 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPVKISHVVSFSSQDPRYPVENLLNPDNPRRPWLSCPQDKSGQLKVELQLERAVPIGYI
DVGNCGCAFLQIDVGRSSWPLDRPFVTLLPATMLMSLTDSKQGKNRSGVRMFKDGKEGKS
RKDGDGLYEKQRCSTKEGCECY
Download sequence
Identical sequences A0A1D5R7P1
ENSMMUP00000009600 ENSMMUP00000009600 9544.ENSMMUP00000009600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]