SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009608 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009608
Domain Number 1 Region: 56-151
Classification Level Classification E-value
Superfamily BolA-like 2.49e-31
Family BolA-like 0.00000667
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009608   Gene: ENSMMUG00000007331   Transcript: ENSMMUT00000010240
Sequence length 152
Comment pep:known chromosome:MMUL_1:20:28169959:28171344:-1 gene:ENSMMUG00000007331 transcript:ENSMMUT00000010240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASAKSPDRWKARLLEGGSTALMYALVRAEVSFPAEVAPVRLQGSVAGVGAGVVSPLGCR
PSWTTAMELSAEYLREKLQRDLEAEHVEVEDTTLNRCACSFRVLVVSAKFEGKPLLQRHR
LVNTCLAEELPHIHAFEQKTLTPEQWARERQK
Download sequence
Identical sequences F7EE67
ENSMMUP00000009608 ENSMMUP00000009608 9544.ENSMMUP00000009608 NP_001181399.1.72884 XP_014981383.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]