SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009784 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009784
Domain Number 1 Region: 4-38
Classification Level Classification E-value
Superfamily WW domain 0.0000000000025
Family WW domain 0.0011
Further Details:      
 
Domain Number 2 Region: 53-88
Classification Level Classification E-value
Superfamily WW domain 0.000000000793
Family WW domain 0.0023
Further Details:      
 
Domain Number 3 Region: 660-763
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000166
Family Synaptotagmin-like (S variant) 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009784   Gene: ENSMMUG00000007457   Transcript: ENSMMUT00000010425
Sequence length 1113
Comment pep:known chromosome:MMUL_1:6:164655768:164832185:1 gene:ENSMMUG00000007457 transcript:ENSMMUT00000010425 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRPELPLPEGWEEARDFDGKVYYIDHTNRTTSWIDPRDRYTKPLTFADCISDELPLGWE
EAYDPQVGDYFIDHNTKTTQIEDPRVQWRREQEHMLKDYLVVAQEALSAQKEIYQVKQQR
LELAQQEYQQLHAVWEHKLGSQVSLVSGSSSSSKYDPEILKAEIATAKSRVNKLKREMVH
LQHELQFKERGFQTLKKIDKKMSDAQGSYKLDEAQAVLRETKAIKKAITCGEKEKQDLIK
SLAMLKDGFRTDRGSHSDLWSSSSSLESSSFPLPKQYLDVSSQTDISGSFSINSNNQLAE
KVRLRLRYEEAKRRIANLKIQLAKLDSEAWPGVLDSERDRLILINEKEELLKEMRFISPR
KWTQGEVEQLEMARKRLEKDLQAARDTQSKALTERLKLNSKRNQLVRELEEATRQVATLH
SQLKSLSSSMQSLSSGSSPGSLTSSRGSLVASSLDSSTSASFTDLYYDPFEQLDSELQSK
VEFLLLEGATGFRPSGCITTIHEDEVAKTQKAEGGGRLQALRSLSGTPKSMTSLSPRSSL
SSPSPPCSPLMADPLLAGDAFLNSLELEDPELSATLCELNLGNSTQERYRLEEPGTEGKQ
LGQAVNTAQGCGLKVACVSAAVSDESVAGDSGVYEASVQRLGASEAAAFDSDESEALGAA
RVQIALKYDEKNKQFAILIIQLSNLSALLQQQDQKVNIRVAVLPCSESTTCLFRTRPLDA
SDTLVFNEVFWVSMSYPALHQKTLRVDVCTTDRSHLEECLVRAVLVHPELQEEGLKETQY
TIMLLFLPCSKQNKQMDPLPFTAPAPGPASTDAVSALLEQTAVELEKRQEGRSGTQTLED
SWRYEETSENEAVAEEEEEEVEEEEEEEDVFTEKASPDMDGYPALKVDKETNTETPAPSP
TVVRPKDRRVGTPSPGPFLRGSTIIRSKTFSPGPQSQYVCRLNRSDSDSSTLSKKPPFVR
NSLERRSVRMKRPSSVKSLRSERLIRTSLDLELDLQATRTWHSQLTQEISVLKELKEQLE
QAKSHGEKELPQWLREDERFRLLLRMLEKRQMDQAEHKGELQTDKMMRAAAKDVHRLRGQ
SCKEPPEVQSFREKMAFFTRPRMNIPALSADDV
Download sequence
Identical sequences ENSMMUP00000009784 ENSMMUP00000009784 9544.ENSMMUP00000009784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]