SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009824 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009824
Domain Number 1 Region: 22-117
Classification Level Classification E-value
Superfamily Immunoglobulin 1.47e-22
Family I set domains 0.011
Further Details:      
 
Domain Number 2 Region: 263-350
Classification Level Classification E-value
Superfamily Immunoglobulin 8.34e-20
Family I set domains 0.01
Further Details:      
 
Domain Number 3 Region: 138-244
Classification Level Classification E-value
Superfamily Immunoglobulin 1.15e-19
Family I set domains 0.016
Further Details:      
 
Domain Number 4 Region: 810-903
Classification Level Classification E-value
Superfamily Immunoglobulin 3.78e-16
Family I set domains 0.02
Further Details:      
 
Domain Number 5 Region: 901-995
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000463
Family I set domains 0.05
Further Details:      
 
Domain Number 6 Region: 344-439
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000341
Family I set domains 0.019
Further Details:      
 
Domain Number 7 Region: 731-822
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000115
Family I set domains 0.017
Further Details:      
 
Domain Number 8 Region: 526-615
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000388
Family Fibronectin type III 0.0041
Further Details:      
 
Domain Number 9 Region: 444-553
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000161
Family I set domains 0.0083
Further Details:      
 
Domain Number 10 Region: 629-727
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000377
Family I set domains 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009824   Gene: ENSMMUG00000007481   Transcript: ENSMMUT00000010467
Sequence length 1036
Comment pep:known chromosome:MMUL_1:12:83410570:83420053:-1 gene:ENSMMUG00000007481 transcript:ENSMMUT00000010467 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGRCRRSETAAMKASSGDQGSPPCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGG
QQLAASERLSFLADGAEHGLLLSTALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASEP
EPQPAERPLPPPGSGEGAPVFLTGPRSQWVLRGVEVVLTCRAGGLPEPTLYWEKDGMALD
EVWDSSHFALEPGRAEEGPGASLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQP
PESPPSDPDEAPAPVVEPLKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPD
RRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQLHVKEPRLRFTRPLQD
VEGREHGIAVLECKVPNSRIPTAWFREDQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGV
YLCEMRGRVRTVANVTVKGPILKRLPRKLDVLEGENAVLLVETLEAGVEGRWSRDGEELP
VICQSSSGHMHALVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPVSAEMFKG
HKNTVLLTWKPPDPAPETPFIYRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYR
FRICTVSGHGRSPHVVFHGSAHLVPTARLVTGLEDVQVYNGEDAVFSLDLSTIIQGTWFL
NGEELKSNEPEGQVEPGALRYRMEQKGLQHRLILHAVKHQDSGALVGFSCPGVQDSAALT
IQESPVHILSPQDKVSLTFTTSDRVVLTCELSRVDFPATWYKDGQKVEESELLVVKMDGR
KHRLILPEAKVQDSGEFECRTEGVSAFFGVTVQDPPVHIVEPREHVFVHAITSECVMLAC
EVDREDAPVCWYKDGQEVEESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAGDERAYFT
VTITDVSSWIVYPSGKVYVAAVRLERVVLTCELCRPWAEVRWTKDGEEVVESPALLLQKE
DTVRRLVLPSVQLEDSGEYLCEIDDESASFTLTVTESYQSQDSSNNNPELCVLLKKPKTR
RLWSRFPPWRRTAGTE
Download sequence
Identical sequences ENSMMUP00000009824 9544.ENSMMUP00000009824 ENSMMUP00000009824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]