SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009849 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009849
Domain Number 1 Region: 332-619
Classification Level Classification E-value
Superfamily Kelch motif 4.32e-62
Family Kelch motif 0.0000826
Further Details:      
 
Domain Number 2 Region: 9-124
Classification Level Classification E-value
Superfamily POZ domain 7.85e-30
Family BTB/POZ domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009849   Gene: ENSMMUG00000007501   Transcript: ENSMMUT00000010496
Sequence length 643
Comment pep:known chromosome:MMUL_1:X:19407909:19409840:-1 gene:ENSMMUG00000007501 transcript:ENSMMUT00000010496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYFLSYCKAHGGALLTGYQALRAEGFLCDVTLETEGSEFPAHRSLLACSSDYFRALFKS
HTQESRARVIHLHVPSAAGLQRLLDFIYTAWLSLSMDTVEDTLEAASYLQVTEALGLCGR
YLERQLAPENCCFAANVASRFGLAHTLDAAERCIVRHLRELLARGAGPAGLLELNPTSLR
AVLGAPDVARVPEARLLGLALAWLRQEPTTERLAHCTELLEHVRFGLVPADVLRRVYSGS
GLVLPARVKGLIIQALNYHTTPSRQPLMQGEQTSIRSPQTRILLVGGRRAREVVIEEVVA
PQRAARGRVAAPEPEEEEEELEEEEEEEWELTQNVVAFDVYNHRWRSLTQLPTPLLGHSV
CTAGNFLFVLGGESPSGSVTSTLADSPRVVTAEVHRYDPRFHAWMEVPAMQEARAHFWCG
AVGGRLLAVGGLGAGGEALASVEMYDLRRDRWTAAGALPRALHGHAGAVGDRGVVYISGG
KAGRGEGGASSLRDLYVLGPEEQAWSKRAPMGTARFGHHMAVLRGAVFAFLGRYEPFSEI
ERYDPGADQWTRLRPLPYDRFCYGLAVVEETALLLGGLKWRDSRQVPTRNVVGYDLDLDR
WEDIGCALPWAWSGLQCAVLQLADGGDEEREGEPGEALDLVLG
Download sequence
Identical sequences F6QK71 G7Q2C7
ENSMMUP00000009849 XP_001086668.1.72884 9544.ENSMMUP00000009849 ENSMMUP00000009849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]