SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009903 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009903
Domain Number 1 Region: 255-335
Classification Level Classification E-value
Superfamily Chaperone J-domain 4.71e-20
Family Chaperone J-domain 0.0007
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000009903
Domain Number - Region: 102-133
Classification Level Classification E-value
Superfamily Subtilisin-like 0.0578
Family Subtilases 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009903   Gene: ENSMMUG00000007548   Transcript: ENSMMUT00000010557
Sequence length 341
Comment pep:known chromosome:MMUL_1:11:46475427:46480047:1 gene:ENSMMUG00000007548 transcript:ENSMMUT00000010557 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKGLLVTYALWAVGGPAGLHHLYLGRDSHALLWMLTLGGGGLGWLWEFWKLPSFVAQAN
RAQGQRQSPRGVTPPLSPIRFAAQVIVGIYFGLVALISLSSMVNFYIVALPLAVGLGVLL
VAAVGNQTSDFKNTLVAAFLTSPILYGRPIAILPISVAASITAQKHRRYKALVVSEPFSV
RLYRLGLAYLAFTGPLAYSALCNTAATLSYVAETLGSFLNWFSFFPLLGRLMEFVLLLPY
RIWRLLMGDTGFNSSYFQEWEKLYEFVHSFQDEKCQLAYQVLGLSEGATNEEIHRSYREL
VKVWHPDHNLDQTEEAQRHFLEIQAAYEVLSQPRKPRGSRR
Download sequence
Identical sequences F7GW88
9544.ENSMMUP00000009903 NP_001181377.1.72884 XP_015007112.1.72884 XP_015007113.1.72884 ENSMMUP00000009903 ENSMMUP00000009903 ENSMMUP00000039754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]