SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009951 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009951
Domain Number 1 Region: 42-269
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.44e-74
Family Lectin leg-like 0.00000000416
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000009951
Domain Number - Region: 279-318
Classification Level Classification E-value
Superfamily HMG-box 0.00176
Family HMG-box 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009951   Gene: ENSMMUG00000007580   Transcript: ENSMMUT00000010607
Sequence length 510
Comment pep:known chromosome:MMUL_1:18:52606530:52635889:-1 gene:ENSMMUG00000007580 transcript:ENSMMUT00000010607 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGSRRRGLQARVRPLFCALLLSLSRFVGGDGVGGDPAAGLPHRRFEYKYSFKGPHLVQS
DGTVPFWAHAGNAIPSSDQIRVAPSLKSQRGSVWTKAKAAFENWEVEVTFRVTGRGRIGA
DGLAIWYTENQGLEGPVFGSADLWNGVGIFFDSFDNDGKKNNPAIVIIGNNGQIHYDHQN
DGASQALASCQRDFRNKPYPVRAKIIYYQKTLTVMINNGFTPDKNDYEFCAKVENMIIPA
QGHFGISAATGGLADDHDVLSFLTFQLTEPGKEPPTPDKEISEKEKEKYQEEFEHFQQEL
DKKKEEFQKGHPDLQGQPAEEIFESVGDRELRQVFEGQNRIHLEIKQLNRQLDMILDEQR
RYVSSLTEEISKRGAGMPGQHGQISQQELDTVVKTQHEILRQVNEMKNSMSETVRLVSGM
QHPGSAGGVYETAQHFADIKEHLHTVKRDVDNLVQRNMLSNEKSKCPELPPFPSCLSTVH
FIIFVVVQTVLFIGYIMYRSQQEAAAKKFF
Download sequence
Identical sequences F6SS58
NP_001248001.1.72884 ENSMMUP00000009951 9544.ENSMMUP00000009951 ENSMMUP00000009951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]